Diaphorina citri psyllid: psy17459


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MYVRLPSLGRGFDSHPGRILSRWDSVRSGNGGLSSILSSFSLRFRDDKTLAVTVPPVKPFLKKCIFLNQNLYFLPPGYNYKEKPNLLAQETQSLACVLRILFKMATSEQMRPSWGSIEQQLIGVNQEALQYFLSLQYEMHRDAWTSLLLLILTKILKMSDDKVRPATHCQVDLTGGLDQVYLSGLPVPRHGQTCGKGMAELVVIKLKT
ccccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHccccccHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHcccccccccccccccccccEEEEEcccc
*Y*RLP*LGRGFDSHP**ILSRWDSVR****G**SILSSFSLRFRDDKTLAVTVPPVKPFLKKCIFLNQNLYFLPPGYNYKEKPNLLAQETQSLACVLRILFKMATSEQMRPSWGSIEQQLIGVNQEALQYFLSLQYEMHRDAWTSLLLLILTKILKMSDDKVRPATHCQVDLTGGLDQVYLSGLPVPRHGQTCGKGMAELVVIKLK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYVRLPSLGRGFDSHPGRILSRWDSVRSGNGGLSSILSSFSLRFRDDKTLAVTVPPVKPFLKKCIFLNQNLYFLPPGYNYKEKPNLLAQETQSLACVLRILFKMATSEQMRPSWGSIEQQLIGVNQEALQYFLSLQYEMHRDAWTSLLLLILTKILKMSDDKVRPATHCQVDLTGGLDQVYLSGLPVPRHGQTCGKGMAELVVIKLKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Brefeldin A-inhibited guanine nucleotide-exchange protein 1 Promotes guanine-nucleotide exchange on ARF1 and ARF3. Promotes the activation of ARF1/ARF3 through replacement of GDP with GTP.confidentO46382
Brefeldin A-inhibited guanine nucleotide-exchange protein 1 Promotes guanine-nucleotide exchange on ARF1 and ARF3. Promotes the activation of ARF1/ARF3 through replacement of GDP with GTP.confidentQ9Y6D6
Brefeldin A-inhibited guanine nucleotide-exchange protein 1 Promotes guanine-nucleotide exchange on ARF1 and ARF3. Promotes the activation of ARF1/ARF3 through replacement of GDP with GTP. Involved in vesicular trafficking. Required for the maintenance of Golgi structure; the function may be independent of its GEF activity. Required for the maturaion of integrin beta-1 in the Golgi. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. Proposed to act as A kinase-anchoring protein (AKAP) and may mediate crosstalk between Arf and PKA pathways. Inhibits GAP activity of MYO9B probably through competetive RhoA binding. The function in the nucleus remains to be determined.confidentD4A631

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted