Diaphorina citri psyllid: psy17466

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

MSAPQEQVSSLPLPPVQYINNYTDELIRRGRAPKPPLPIHDSYSMFGNQFNADDTIIRPLESQGIKRLYPQHFDRRRELRKLNHSLLVNFLDLIDLLVQCPDSPRRTEKVEDISLLFIHIHHLLNEFRPHQARETLRVMMELQRRQRNETSQRFHVHLDRVNQILNQAIENLPDTDLDSKLLINTDDFNSNDSNRKDDASVDGVNPYDRLMCELVDNMPLTNDGFK

cccccccccccccccHHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHcccccccccccccccccccccccccHHHHHHHHHHHHccccccccc

**********LPLPPVQYINNYTDELIR*********PIHDSYSMFGNQFNADDTIIRPLESQGIKRLYPQHFDRRRELRKLNHSLLVNFLDLIDLLVQCPDSPRRTEKVEDISLLFIHIHHLLNEFRPHQARETLRVMMELQRRQRNETSQRFHVHLDRVNQILNQAIENLPD********************************YDRLMCELVDNMPLTND***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mediator of RNA polymerase II transcription subunit 7	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.	very confident	Q2F7Z4
Mediator of RNA polymerase II transcription subunit 7	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.	very confident	O43513
Mediator of RNA polymerase II transcription subunit 7	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.	very confident	Q3T123

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016592 [CC]	mediator complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0003713 [MF]	transcription coactivator activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0006367 [BP]	transcription initiation from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0019827 [BP]	stem cell maintenance	probable	GO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0001104 [MF]	RNA polymerase II transcription cofactor activity	probable	GO:0001076, GO:0003674, GO:0003712, GO:0000989, GO:0000988

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YKH, chain A
Confidence level:very confident
Coverage over the Query: 94-166
View the alignment between query and template
View the model in PyMOL

Template: 3FBI, chain A
Confidence level:confident
Coverage over the Query: 10-50
View the alignment between query and template
View the model in PyMOL