Diaphorina citri psyllid: psy17468


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MDYEVPMKKLSEEFIPHAKLLFQALMSLRAIYSYRNVSADQMRNDQKLSLVGNPGQLLKPARTERMSCEYLSQESLDRWIIFGFMLCHQPLSQEPVSKLWTAALENNWVIALFRDEVIYIHQYIQGFFDTIKGYGKRVSEVKDCYSHAVSKAALEHREKRKFLRTALKELGLLFSDQPGLLGPKALLIFIGLSYARDEVYWLLRHNDNPPVQKGKSKSAEDLVDRQLPELEMKFIAEGAIPFNAEEFSDVNELRALADLIGPYGMKLLNETLMWHIASQVQELKKLVAANKEVLLLLRTHFDKPEIMKEQSKRLHNVENVLQRMTIIGVILNFQRIAQLALQEVLESRVPFLLNSVQDFYQHSPVGDPKIVNEMASAAGLLCTVDPALATALASDKTDLDEDEHVLACLLMVFVAVCIPKLARNEACFYLASLEGHSNNIHCMASAINHIFSALFTLCGQGDLEDRMKEFLALTSSSLLRLGQDPDEESTRHRDSVYLLLHQIVQESPFLTMDLLESCFPYALIRNAYHAVSKQEHAM
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHcccccHHHHHHHccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHHHccccc
MDYEVPMKKLSEEFIPHAKLLFQALMSLRAIYSYRNVSADQMRNDQKLSLVGNPGQLLKPARTERMSCEYLSQESLDRWIIFGFMLCHQPLSQEPVSKLWTAALENNWVIALFRDEVIYIHQYIQGFFDTIKGYGKRVSEVKDCYSHAVSKAALEHREKRKFLRTALKELGLLFSDQPGLLGPKALLIFIGLSYARDEVYWLLRHN****************VDRQLPELEMKFIAEGAIPFNAEEFSDVNELRALADLIGPYGMKLLNETLMWHIASQVQELKKLVAANKEVLLLLRTHFDKPEIMKEQSKRLHNVENVLQRMTIIGVILNFQRIAQLALQEVLESRVPFLLNSVQDFYQHSPVGDPKIVNEMASAAGLLCTVDPALATALASDKTDLDEDEHVLACLLMVFVAVCIPKLARNEACFYLASLEGHSNNIHCMASAINHIFSALFTLCGQGDLEDRMKEFLALTSSSLL**************DSVYLLLHQIVQESPFLTMDLLESCFPYALIRNAYHAVSK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYEVPMKKLSEEFIPHAKLLFQALMSLRAIYSYRNVSADQMRNDQKLSLVGNPGQLLKPARTERMSCEYLSQESLDRWIIFGFMLCHQPLSQEPVSKLWTAALENNWVIALFRDEVIYIHQYIQGFFDTIKGYGKRVSEVKDCYSHAVSKAALEHREKRKFLRTALKELGLLFSDQPGLLGPKALLIFIGLSYARDEVYWLLRHNDNPPVQKGKSKSAEDLVDRQLPELEMKFIAEGAIPFNAEEFSDVNELRALADLIGPYGMKLLNETLMWHIASQVQELKKLVAANKEVLLLLRTHFDKPEIMKEQSKRLHNVENVLQRMTIIGVILNFQRIAQLALQEVLESRVPFLLNSVQDFYQHSPVGDPKIVNEMASAAGLLCTVDPALATALASDKTDLDEDEHVLACLLMVFVAVCIPKLARNEACFYLASLEGHSNNIHCMASAINHIFSALFTLCGQGDLEDRMKEFLALTSSSLLRLGQDPDEESTRHRDSVYLLLHQIVQESPFLTMDLLESCFPYALIRNAYHAVSKQEHAM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Membrane-associated protein Hem Plays a role during growth of the oocyte.confidentP55162
Nck-associated protein 1 Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1.confidentB0S6R1
Nck-associated protein 1 Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1.confidentP28660

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0045175 [BP]basal protein localizationprobableGO:0033036, GO:0008105, GO:0008104, GO:0008150, GO:0051179
GO:0045176 [BP]apical protein localizationprobableGO:0033036, GO:0008105, GO:0008104, GO:0008150, GO:0051179
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0030031 [BP]cell projection assemblyprobableGO:0022607, GO:0030030, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0007528 [BP]neuromuscular junction developmentprobableGO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0001764 [BP]neuron migrationprobableGO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0031209 [CC]SCAR complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0008407 [BP]chaeta morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0007275, GO:0022416
GO:0030866 [BP]cortical actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030865, GO:0044763, GO:0030036, GO:0008150, GO:0044699, GO:0016043
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3p8c, chain Bvery confident Alignment | Template Structure