Diaphorina citri psyllid: psy17486


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
cEEEEEEEcccccccccccEEEEccccccccccccccEEEccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHc
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGV************************GG*********KIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2-22 kDa Catalyzes the covalent attachment of ubiquitin to other proteins.confidentP52486
Ubiquitin-conjugating enzyme E2 K Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. Involved in stabilization of CASP12 during ER stress-mediated beta-amyloid neurotoxicity probably by inhibiting proteasome activity; in vitro ubiquitinates CASP12.confidentP61087
Ubiquitin-conjugating enzyme E2 K Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.confidentP61086

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070936 [BP]protein K48-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0034450 [MF]ubiquitin-ubiquitin ligase activityprobableGO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0006301 [BP]postreplication repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0032434 [BP]regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009894, GO:0032268, GO:0080090, GO:0031329, GO:0060255, GO:0061136, GO:0031323, GO:0051246, GO:0050794, GO:0008150, GO:0042176, GO:0030162, GO:0065007, GO:0019222, GO:0050789
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0031372 [CC]UBC13-MMS2 complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031371
GO:0044314 [BP]protein K27-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0070059 [BP]intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stressprobableGO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0007569, GO:0035556, GO:0044699, GO:0051716, GO:0050789, GO:0065007, GO:0010259, GO:0006915, GO:0009987, GO:0050794, GO:0012501, GO:0006950, GO:0008150, GO:0007154, GO:0044700, GO:0050896, GO:0033554, GO:0044763, GO:0034976
GO:0035519 [BP]protein K29-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0042769 [BP]DNA damage response, detection of DNA damageprobableGO:0051716, GO:0051606, GO:0050896, GO:0009987, GO:0006974, GO:0006950, GO:0008150, GO:0033554, GO:0044763, GO:0044699
GO:0070534 [BP]protein K63-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000151 [CC]ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006513 [BP]protein monoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0033182 [BP]regulation of histone ubiquitinationprobableGO:0033044, GO:0032268, GO:0080090, GO:0019222, GO:0033043, GO:0060255, GO:0051246, GO:0031056, GO:0031323, GO:0051128, GO:0065007, GO:0031399, GO:0031396, GO:0008150, GO:0050794, GO:0050789
GO:0035370 [CC]UBC13-UEV1A complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031371
GO:0031058 [BP]positive regulation of histone modificationprobableGO:0033044, GO:0009893, GO:0019222, GO:0033043, GO:0031325, GO:0031323, GO:0051128, GO:0031056, GO:0050789, GO:0080090, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0051130, GO:0060255, GO:0050794, GO:0008150, GO:0032268, GO:0031401, GO:0010638, GO:2001252, GO:0048522
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0016574 [BP]histone ubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0085020 [BP]protein K6-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0000502 [CC]proteasome complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043130 [MF]ubiquitin bindingprobableGO:0003674, GO:0032182, GO:0005488, GO:0005515
GO:0051865 [BP]protein autoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0051443 [BP]positive regulation of ubiquitin-protein ligase activityprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051438, GO:0050789, GO:0043085, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0031398, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0031401, GO:0051351, GO:0048522
GO:0045739 [BP]positive regulation of DNA repairprobableGO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0006282, GO:0051052, GO:0060255, GO:0048583, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:2001020, GO:2001022, GO:0080134, GO:0080135, GO:0048522
GO:0000724 [BP]double-strand break repair via homologous recombinationprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0070979 [BP]protein K11-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0000729 [BP]DNA double-strand break processingprobableGO:0044238, GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:0051716, GO:0044265, GO:0006302, GO:0044260, GO:0006308, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:1901575, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0000738, GO:0044270, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0008150
GO:0010994 [BP]free ubiquitin chain polymerizationprobableGO:0051258, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0032844, GO:0065003, GO:0044085, GO:0065007, GO:0071840, GO:0034622, GO:0008150, GO:0050794, GO:0043623, GO:0050789, GO:0010993

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E46, chain A
Confidence level:very confident
Coverage over the Query: 2-88,115-172
View the alignment between query and template
View the model in PyMOL
Template: 1TTE, chain A
Confidence level:very confident
Coverage over the Query: 2-38,54-151
View the alignment between query and template
View the model in PyMOL