Psyllid ID: psy17486


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
cEEEEEEEcccccccccccEEEEccccccccccccccEEEccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHc
cEEEEEEEccccccccccEEEEcccccEccEcccccEEccHHHcccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccHcccccccHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHc
MVDTTVKFVTKiwhpnissvKFLTKiwhpnissvtGAICLDILKDQWAAAMTLRTVLLSLQALMaaaepddpqdAVVAKQYKENPEMFTLTARHWTNVYAGVVAKqykenpemFTLTARHwtnvyaggpsknpdfdskiqrltdmgvmsHDARVALSTYNWELERATEAIFT
MVDTTVKFvtkiwhpnissVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVyaggpsknpdfDSKIQRLTDMGVMSHDARVALstynwelerateaift
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
****TVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAA*********VVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGG************RLTDMGVMSHDARVALSTYNWELER*******
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAG************************************KIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGV************************GGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
P52486199 Ubiquitin-conjugating enz yes N/A 0.813 0.703 0.584 2e-42
P61087200 Ubiquitin-conjugating enz yes N/A 0.761 0.655 0.566 2e-36
P61086200 Ubiquitin-conjugating enz yes N/A 0.761 0.655 0.566 2e-36
P61085200 Ubiquitin-conjugating enz yes N/A 0.761 0.655 0.566 2e-36
P52484214 Probable ubiquitin-conjug no N/A 0.726 0.584 0.493 2e-33
Q9FI61192 Ubiquitin-conjugating enz yes N/A 0.715 0.640 0.405 1e-27
P21734215 Ubiquitin-conjugating enz yes N/A 0.616 0.493 0.495 5e-23
O74810217 Ubiquitin-conjugating enz yes N/A 0.494 0.391 0.552 3e-22
Q9FZ48153 Ubiquitin-conjugating enz no N/A 0.465 0.522 0.555 1e-19
Q94A97153 Ubiquitin-conjugating enz no N/A 0.465 0.522 0.555 2e-19
>sp|P52486|UBCD4_DROME Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophila melanogaster GN=UbcD4 PE=1 SV=2 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 115/171 (67%), Gaps = 31/171 (18%)

Query: 7   KFVTKIWHP-----NISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQ 61
           KFV +I  P     N   V+F+T+IWHPNISSVTGAICLDILKD WAAAMTLRTVLLSLQ
Sbjct: 55  KFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQ 114

Query: 62  ALMAAAEPDDPQDAVVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHW 121
           AL+AAAEPDDPQDAVVA Q+K+  ++F LTA+HWT                         
Sbjct: 115 ALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWT------------------------- 149

Query: 122 TNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT 172
            N YAGGP   PD DSKIQRL DMG+  H+AR  LS  NW LE+ATE +F+
Sbjct: 150 -NAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATEGLFS 199




Catalyzes the covalent attachment of ubiquitin to other proteins.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|P61087|UBE2K_MOUSE Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=1 SV=3 Back     alignment and function description
>sp|P61086|UBE2K_HUMAN Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens GN=UBE2K PE=1 SV=3 Back     alignment and function description
>sp|P61085|UBE2K_BOVIN Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN=UBE2K PE=1 SV=3 Back     alignment and function description
>sp|P52484|UBC21_CAEEL Probable ubiquitin-conjugating enzyme E2 21 OS=Caenorhabditis elegans GN=ubc-21 PE=3 SV=3 Back     alignment and function description
>sp|Q9FI61|UBC27_ARATH Ubiquitin-conjugating enzyme E2 27 OS=Arabidopsis thaliana GN=UBC27 PE=2 SV=1 Back     alignment and function description
>sp|P21734|UBC1_YEAST Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC1 PE=1 SV=1 Back     alignment and function description
>sp|O74810|UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc1 PE=3 SV=2 Back     alignment and function description
>sp|Q9FZ48|UBC36_ARATH Ubiquitin-conjugating enzyme E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1 Back     alignment and function description
>sp|Q94A97|UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
240848551199 ubiquitin-conjugating enzyme E2-25kD-lik 0.761 0.658 0.675 6e-53
156553415205 PREDICTED: ubiquitin-conjugating enzyme 0.761 0.639 0.668 3e-48
383853187199 PREDICTED: ubiquitin-conjugating enzyme 0.808 0.698 0.641 9e-48
110748673199 PREDICTED: ubiquitin-conjugating enzyme 0.808 0.698 0.635 2e-47
340715521187 PREDICTED: ubiquitin-conjugating enzyme 0.761 0.700 0.662 3e-47
427795629232 Putative ubiquitin-protein ligase, parti 0.761 0.564 0.668 5e-47
346465869242 hypothetical protein [Amblyomma maculatu 0.761 0.541 0.668 6e-47
260908642169 ubiquitin protein ligase [Rhipicephalus 0.761 0.775 0.656 1e-46
357631555199 ubiquitin conjugating enzyme 4 [Danaus p 0.761 0.658 0.643 3e-46
189235252199 PREDICTED: similar to ubiquitin conjugat 0.808 0.698 0.629 4e-46
>gi|240848551|ref|NP_001155723.1| ubiquitin-conjugating enzyme E2-25kD-like [Acyrthosiphon pisum] gi|239790683|dbj|BAH71888.1| ACYPI007620 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 106/157 (67%), Positives = 116/157 (73%), Gaps = 26/157 (16%)

Query: 16  NISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 75
           N   V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA
Sbjct: 69  NPPKVRFMTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 128

Query: 76  VVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDF 135
           VVAKQYKE PE+F  TA HWTN                          VYAGGP+KN +F
Sbjct: 129 VVAKQYKEYPEIFAKTASHWTN--------------------------VYAGGPNKNSEF 162

Query: 136 DSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT 172
           D+KIQRL DMG+    AR ALSTYNW+LERATE +F+
Sbjct: 163 DTKIQRLIDMGIERDQARGALSTYNWDLERATEQLFS 199




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156553415|ref|XP_001599342.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383853187|ref|XP_003702104.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|110748673|ref|XP_001120470.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis mellifera] gi|340715519|ref|XP_003396259.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like isoform 1 [Bombus terrestris] gi|350406268|ref|XP_003487714.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Bombus impatiens] gi|380012913|ref|XP_003690517.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis florea] Back     alignment and taxonomy information
>gi|340715521|ref|XP_003396260.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|427795629|gb|JAA63266.1| Putative ubiquitin-protein ligase, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|346465869|gb|AEO32779.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|260908642|gb|ACX54040.1| ubiquitin protein ligase [Rhipicephalus sanguineus] Back     alignment and taxonomy information
>gi|357631555|gb|EHJ79025.1| ubiquitin conjugating enzyme 4 [Danaus plexippus] Back     alignment and taxonomy information
>gi|189235252|ref|XP_971328.2| PREDICTED: similar to ubiquitin conjugating enzyme-like protein [Tribolium castaneum] gi|270004126|gb|EFA00574.1| hypothetical protein TcasGA2_TC003444 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
UNIPROTKB|P61085200 UBE2K "Ubiquitin-conjugating e 0.563 0.485 0.767 1.9e-35
UNIPROTKB|E2R6W9200 UBE2K "Uncharacterized protein 0.563 0.485 0.767 1.9e-35
UNIPROTKB|J9NW86200 UBE2K "Uncharacterized protein 0.563 0.485 0.767 1.9e-35
UNIPROTKB|P61086200 UBE2K "Ubiquitin-conjugating e 0.563 0.485 0.767 1.9e-35
UNIPROTKB|Q06AB2200 UBE2K "Uncharacterized protein 0.563 0.485 0.767 1.9e-35
MGI|MGI:1858216200 Ube2k "ubiquitin-conjugating e 0.563 0.485 0.767 1.9e-35
RGD|1311626186 Ube2k "ubiquitin-conjugating e 0.563 0.521 0.767 1.9e-35
ZFIN|ZDB-GENE-980605-9200 ube2kb "ubiquitin-conjugating 0.5 0.43 0.848 2.4e-35
UNIPROTKB|F1NIP7178 UBE2K "Uncharacterized protein 0.563 0.544 0.767 2.4e-35
UNIPROTKB|F1NNF1187 UBE2K "Uncharacterized protein 0.563 0.518 0.767 2.4e-35
UNIPROTKB|P61085 UBE2K "Ubiquitin-conjugating enzyme E2 K" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 1.9e-35, P = 1.9e-35
 Identities = 76/99 (76%), Positives = 84/99 (84%)

Query:    16 NISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 75
             N   V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQAL+AAAEPDDPQDA
Sbjct:    69 NPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDA 128

Query:    76 VVAKQYKENPEMFTLTARHWTNVYAG--VVAKQYKENPE 112
             VVA QYK+NPEMF  TAR W +VYAG  V + +Y +  E
Sbjct:   129 VVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIE 167


GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0070936 "protein K48-linked ubiquitination" evidence=ISS
GO:0031625 "ubiquitin protein ligase binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=IEA
GO:0034450 "ubiquitin-ubiquitin ligase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|E2R6W9 UBE2K "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW86 UBE2K "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61086 UBE2K "Ubiquitin-conjugating enzyme E2 K" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q06AB2 UBE2K "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1858216 Ube2k "ubiquitin-conjugating enzyme E2K" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311626 Ube2k "ubiquitin-conjugating enzyme E2K" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980605-9 ube2kb "ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIP7 UBE2K "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNF1 UBE2K "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P61087UBE2K_MOUSE6, ., 3, ., 2, ., 1, 90.56680.76160.655yesN/A
P61086UBE2K_HUMAN6, ., 3, ., 2, ., 1, 90.56680.76160.655yesN/A
P61085UBE2K_BOVIN6, ., 3, ., 2, ., 1, 90.56680.76160.655yesN/A
Q86K32UBE2N_DICDI6, ., 3, ., 2, ., 1, 90.50530.53480.5974yesN/A
P52486UBCD4_DROME6, ., 3, ., 2, ., 1, 90.58470.81390.7035yesN/A
Q9FI61UBC27_ARATH6, ., 3, ., 2, ., 1, 90.40520.71510.6406yesN/A
O74810UBC1_SCHPO6, ., 3, ., 2, ., 1, 90.55290.49410.3917yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.190.914
3rd Layer6.3.20.921

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 4e-32
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 4e-32
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 6e-32
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 5e-30
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 8e-29
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 6e-22
cd0019438 cd00194, UBA, Ubiquitin Associated domain 3e-04
smart0016537 smart00165, UBA, Ubiquitin associated domain 7e-04
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
 Score =  111 bits (281), Expect = 4e-32
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 2/79 (2%)

Query: 19  SVKFLTKIWHPNISSVTGAICLDILKDQ-WAAAMTLRTVLLSLQALMAAAEPDDPQDAVV 77
            VKF TKI+HPN+   +G ICLDILKD+ W+ A+T+  VLLS+Q+L++   P+DP +A  
Sbjct: 62  KVKFTTKIYHPNVDP-SGEICLDILKDENWSPALTIEQVLLSIQSLLSEPNPEDPLNAEA 120

Query: 78  AKQYKENPEMFTLTARHWT 96
           AK Y++N E F    R + 
Sbjct: 121 AKLYRKNREEFEKKVREYV 139


Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139

>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
KOG0418|consensus200 100.0
KOG0417|consensus148 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.98
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.97
KOG0419|consensus152 99.97
KOG0425|consensus171 99.96
KOG0424|consensus158 99.96
KOG0422|consensus153 99.95
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.94
KOG0420|consensus184 99.94
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.93
KOG0421|consensus175 99.93
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.93
KOG0416|consensus189 99.92
KOG0426|consensus165 99.91
KOG0423|consensus223 99.86
KOG0427|consensus161 99.6
KOG0429|consensus258 99.36
KOG0894|consensus244 99.17
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.65
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.6
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 98.58
KOG0895|consensus1101 98.57
KOG0428|consensus314 98.35
KOG0897|consensus122 98.16
KOG0895|consensus 1101 98.11
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.0
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 97.9
KOG0896|consensus138 97.83
KOG0011|consensus 340 97.35
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 97.23
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 97.09
KOG2391|consensus 365 96.51
KOG0417|consensus148 96.38
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 95.78
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 95.58
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 95.06
KOG0418|consensus200 94.64
KOG0011|consensus340 94.43
smart0054643 CUE Domain that may be involved in binding ubiquit 94.04
KOG0944|consensus763 91.63
KOG2561|consensus 568 88.53
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 88.22
PF14457162 Prok-E2_A: Prokaryotic E2 family A 88.07
smart00591107 RWD domain in RING finger and WD repeat containing 85.76
KOG2561|consensus 568 85.18
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 84.84
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 84.82
PRK06369115 nac nascent polypeptide-associated complex protein 83.86
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 83.79
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 82.3
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 80.36
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 80.21
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 80.07
>KOG0418|consensus Back     alignment and domain information
Probab=100.00  E-value=3.5e-45  Score=279.78  Aligned_cols=144  Identities=53%  Similarity=0.849  Sum_probs=137.8

Q ss_pred             CCcEEEEcCCCCCCCCCeeEEecccccccccCCCCceecccCCCCcCCcCCHHHHHHHHHHhhcCCCCCChHHHHHHHHH
Q psy17486          2 VDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQY   81 (172)
Q Consensus         2 ~~~~i~F~p~~YP~~pP~v~F~t~i~HPnV~~~~G~icl~~l~~~W~p~~~l~~vL~~i~~ll~~p~~~~p~n~~aa~~~   81 (172)
                      |...|++ |++|||+||+|+|.|+||||||++.+|.||||||++.|++++||+++|++||++|..|+|.||.++.++++|
T Consensus        55 FeldI~i-Pe~YPF~pPkv~F~TkIwHPnVSs~tGaICLDilkd~Wa~slTlrtvLislQalL~~pEp~dPqDavva~qy  133 (200)
T KOG0418|consen   55 FELDIKI-PENYPFKPPKVKFITKIWHPNVSSQTGAICLDILKDQWAASLTLRTVLISLQALLCAPEPKDPQDAVVAEQY  133 (200)
T ss_pred             EEEEEec-CCCCCCCCCceeeeeeeecCCCCcccccchhhhhhcccchhhhHHHHHHHHHHHHcCCCCCChHHHHHHHHH
Confidence            5567888 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCHHHHHHHHHHHHHHHHHHHHHhhhcCchhhHHHHHHHHHHhcCCC-CCCCchHHHHHHHHHcCCChHHHHHHHHhcC
Q psy17486         82 KENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGP-SKNPDFDSKIQRLTDMGVMSHDARVALSTYN  160 (172)
Q Consensus        82 ~~~~~~f~~~ar~~t~~~a~~~~~~~~~~~~~~~~~a~~w~~~~~~~~-~~~~~~~~kv~~l~~~gf~~~~a~~aLs~~~  160 (172)
                      .+|++.|                          .++||.||..||+++ ...+...++|+.|.+|||+++.++.+|+..+
T Consensus       134 ~~n~~~F--------------------------~~TAr~WT~~fA~~~~~~~~~~~~~v~~l~~mGf~~~~~i~~L~~~~  187 (200)
T KOG0418|consen  134 VDNYEMF--------------------------YKTARYWTTEFAGGRLPDDPWDKKKVDSLIEMGFSELEAILVLSGSD  187 (200)
T ss_pred             hhhHHHH--------------------------HHHHHHHHHHHhCCCCCCCchhHHHHHHHHHhcccHHHHHHHhhccc
Confidence            9999999                          899999999999994 4467899999999999999999999999999


Q ss_pred             CChHHHHHHhhC
Q psy17486        161 WELERATEAIFT  172 (172)
Q Consensus       161 W~~~~a~~~l~~  172 (172)
                      |+++.|.+.|++
T Consensus       188 w~~~~a~~~~~s  199 (200)
T KOG0418|consen  188 WNLADATEQLLS  199 (200)
T ss_pred             cchhhhhHhhcc
Confidence            999999999985



>KOG0417|consensus Back     alignment and domain information
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0897|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>KOG2391|consensus Back     alignment and domain information
>KOG0417|consensus Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>KOG0944|consensus Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
3k9p_A217 The Crystal Structure Of E2-25k And Ubiquitin Compl 2e-37
1yla_A202 Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington 2e-37
3k9o_A201 The Crystal Structure Of E2-25k And Ubb+1 Complex L 2e-37
3e46_A253 Crystal Structure Of Ubiquitin-Conjugating Enzyme E 1e-36
2bep_A159 Crystal Structure Of Ubiquitin Conjugating Enzyme E 1e-32
2pwq_A216 Crystal Structure Of A Putative Ubiquitin Conjugati 5e-29
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 2e-24
1tte_A215 The Structure Of A Class Ii Ubiquitin-Conjugating E 9e-24
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 4e-23
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 1e-21
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 2e-21
2c2v_B154 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 3e-20
4epo_B155 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 3e-20
3von_C148 Crystalstructure Of The Ubiquitin Protease Length = 3e-20
3hct_B155 Crystal Structure Of Traf6 In Complex With Ubc13 In 3e-20
1j7d_B152 Crystal Structure Of Hmms2-Hubc13 Length = 152 3e-20
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 3e-18
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 1e-17
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 1e-17
1jat_A155 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 2e-17
1jbb_A153 Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 2e-17
1qcq_A148 Ubiquitin Conjugating Enzyme Length = 148 2e-17
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 8e-17
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 9e-17
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 9e-17
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 1e-16
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-16
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 1e-16
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-16
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 1e-16
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-16
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 1e-16
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 1e-16
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 1e-16
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 2e-16
2gmi_A152 Mms2UBC13~UBIQUITIN Length = 152 3e-16
1x23_A155 Crystal Structure Of Ubch5c Length = 155 4e-16
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 4e-16
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 4e-16
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 4e-16
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 5e-16
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 1e-15
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 2e-15
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 2e-15
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 3e-15
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 4e-15
3jvz_A146 E2~ubiquitin-Hect Length = 146 7e-15
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 9e-15
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 2e-14
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 4e-14
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 5e-14
1yh2_A169 Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 6e-14
1jas_A152 Hsubc2b Length = 152 2e-11
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 7e-11
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 7e-11
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 2e-10
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 2e-10
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 4e-10
2z5d_A179 Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 5e-10
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 1e-09
1y8x_A160 Structural Basis For Recruitment Of Ubc12 By An E2- 2e-08
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 1e-07
3o2u_A190 S. Cerevisiae Ubc12 Length = 190 1e-07
3sqv_C156 Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L 3e-07
1c4z_D154 Structure Of E6ap: Insights Into Ubiquitination Pat 3e-07
2nvu_C180 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 6e-07
2onu_A152 Plasmodium Falciparum Ubiquitin Conjugating Enzyme 6e-07
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 5e-06
3ong_B159 Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 1e-05
2gjd_A157 Distinct Functional Domains Of Ubc9 Dictate Cell Su 1e-05
2edi_A173 Solution Structure Of The Uq_con Domain From Human 2e-05
3fn1_B167 E2-Ring Expansion Of The Nedd8 Cascade Confers Spec 2e-05
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 3e-05
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 3e-05
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 3e-05
1yf9_A171 Structural Analysis Of Leishmania Major Ubiquitin C 3e-05
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 6e-05
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 6e-05
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 7e-05
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 7e-05
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 7e-05
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 7e-05
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 8e-05
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 9e-05
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 2e-04
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 3e-04
1wzv_A155 Crystal Structure Of Ubch8 Length = 155 6e-04
2kjh_A152 Nmr Based Structural Model Of The Ubch8-Ubiquitin C 6e-04
>pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 Back     alignment and structure

Iteration: 1

Score = 151 bits (382), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 89/157 (56%), Positives = 105/157 (66%), Gaps = 26/157 (16%) Query: 16 NISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 75 N V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQAL+AAAEPDDPQDA Sbjct: 86 NPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDA 145 Query: 76 VVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDF 135 VVA QYK+NPEMF TAR W +VYAG P +P++ Sbjct: 146 VVANQYKQNPEMFKQTARLW--------------------------AHVYAGAPVSSPEY 179 Query: 136 DSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT 172 KI+ L MG + VALS+ +W++E ATE + + Sbjct: 180 TKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLS 216
>pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 Back     alignment and structure
>pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 Back     alignment and structure
>pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 Back     alignment and structure
>pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 Back     alignment and structure
>pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 Back     alignment and structure
>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 Back     alignment and structure
>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 Back     alignment and structure
>pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 Back     alignment and structure
>pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 Back     alignment and structure
>pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|1Y8X|A Chain A, Structural Basis For Recruitment Of Ubc12 By An E2-Binding Domain In Nedd8's E1 Length = 160 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 Back     alignment and structure
>pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 Back     alignment and structure
>pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 Back     alignment and structure
>pdb|2NVU|C Chain C, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 180 Back     alignment and structure
>pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 Back     alignment and structure
>pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 Back     alignment and structure
>pdb|2EDI|A Chain A, Solution Structure Of The Uq_con Domain From Human Nedd8- Conjugating Enzyme Nce2 Length = 173 Back     alignment and structure
>pdb|3FN1|B Chain B, E2-Ring Expansion Of The Nedd8 Cascade Confers Specificity To Cullin Modification Length = 167 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 Back     alignment and structure
>pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 7e-59
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 3e-57
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 2e-54
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 2e-49
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 6e-46
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 5e-44
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 1e-43
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 8e-43
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 2e-42
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 4e-42
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 7e-42
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 2e-41
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 3e-41
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 5e-41
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 5e-41
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 6e-41
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 1e-40
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 2e-40
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 8e-40
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 9e-37
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 1e-36
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 1e-36
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 2e-35
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 2e-35
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 6e-35
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 2e-34
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 2e-34
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 9e-34
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 6e-33
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 3e-31
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 7e-31
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 1e-30
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 2e-30
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 4e-29
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 7e-29
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 2e-28
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 3e-28
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 1e-27
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 2e-26
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 8e-24
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 4e-23
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 1e-22
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 2e-22
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 2e-21
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 8e-21
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 1e-20
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 5e-20
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 8e-20
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 2e-18
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 2e-15
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
 Score =  181 bits (461), Expect = 7e-59
 Identities = 88/153 (57%), Positives = 104/153 (67%), Gaps = 26/153 (16%)

Query: 20  VKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAK 79
           V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQAL+AAAEPDDPQDA    
Sbjct: 74  VRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDA---- 129

Query: 80  QYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKI 139
                                 VVA QYK+NPEMF  TAR W +VYAG P  +P++  KI
Sbjct: 130 ----------------------VVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKI 167

Query: 140 QRLTDMGVMSHDARVALSTYNWELERATEAIFT 172
           + L  MG   +   VALS+ +W++E ATE + +
Sbjct: 168 ENLCAMGFDRNAVIVALSSKSWDVETATELLLS 200


>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.98
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.98
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.98
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.98
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.98
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.98
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.98
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.98
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.97
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.97
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.97
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.97
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.97
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.97
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.97
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.97
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.97
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.97
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.97
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.97
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.97
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.97
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.97
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.97
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.97
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.97
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.97
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.97
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.97
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.96
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.96
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.96
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.96
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.96
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.96
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.96
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.93
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 99.93
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.9
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.89
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.88
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.88
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.87
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.86
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.85
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.84
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.78
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.54
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.51
2cwb_A108 Chimera of immunoglobulin G binding protein G and 99.5
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.08
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 98.96
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 98.89
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 98.86
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 98.85
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 98.82
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 98.81
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 98.8
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 98.79
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 98.77
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 98.68
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.67
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.65
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 98.65
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.62
1wji_A63 Tudor domain containing protein 3; UBA domain, str 98.62
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 98.57
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 98.51
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 98.47
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 98.44
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 98.43
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.38
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.36
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 98.35
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 98.29
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 98.26
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 98.22
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.17
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 98.16
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 98.08
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.05
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.04
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 97.99
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 97.96
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.82
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 97.81
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 97.7
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 97.66
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 97.15
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 96.93
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 96.91
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 96.6
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 96.47
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 96.01
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 95.53
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 95.27
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 95.09
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 94.91
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 94.7
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 94.62
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 94.51
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 94.19
2dhy_A67 CUE domain-containing protein 1; structural genomi 92.61
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 92.27
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 88.98
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 85.29
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 85.15
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 84.83
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 84.65
2l2d_A73 OTU domain-containing protein 7A; UBA fold, struct 84.04
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 83.95
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 83.68
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 83.49
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 82.41
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 81.35
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 80.78
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 80.6
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 80.6
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 80.58
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 80.06
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
Probab=100.00  E-value=7e-47  Score=298.38  Aligned_cols=144  Identities=63%  Similarity=0.993  Sum_probs=137.2

Q ss_pred             CCcEEEEcCCCCCCCCCeeEEecccccccccCCCCceecccCCCCcCCcCCHHHHHHHHHHhhcCCCCCChHHHHHHHHH
Q psy17486          2 VDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQY   81 (172)
Q Consensus         2 ~~~~i~F~p~~YP~~pP~v~F~t~i~HPnV~~~~G~icl~~l~~~W~p~~~l~~vL~~i~~ll~~p~~~~p~n~~aa~~~   81 (172)
                      +..+|.| |++||++||+|+|.|+||||||++.+|.|||++|.++|+|+++|++||.+|+++|.+|++++|+|.+|+++|
T Consensus        57 f~~~i~f-p~~YP~~pP~v~f~t~i~HPnv~~~~G~iCl~iL~~~W~p~~~i~~vL~~i~~ll~~p~p~~p~n~~aa~~~  135 (201)
T 3k9o_A           57 YQLEIKI-PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQY  135 (201)
T ss_dssp             EEEEEEC-CTTTTTSCCEEEESSCCCBTTBCTTTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCTTSCSCHHHHHHH
T ss_pred             EEEEEEC-CCcCCCCCCccccccCcccCCCcCCCCeeeCcccccCCCCCCCHHHHHHHHHHHhcCCCCCCcccHHHHHHH
Confidence            4678888 999999999999999999999996699999999999999999999999999999999999999999999999


Q ss_pred             hhCHHHHHHHHHHHHHHHHHHHHHhhhcCchhhHHHHHHHHHHhcCCCCCCCchHHHHHHHHHcCCChHHHHHHHHhcCC
Q psy17486         82 KENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNW  161 (172)
Q Consensus        82 ~~~~~~f~~~ar~~t~~~a~~~~~~~~~~~~~~~~~a~~w~~~~~~~~~~~~~~~~kv~~l~~~gf~~~~a~~aLs~~~W  161 (172)
                      ++|++.|                          .++||+||++||+++...++++++|+.|++|||++++|+.||+.++|
T Consensus       136 ~~~~~~f--------------------------~~~a~~~~~~~a~~~~~~~~~eekV~~l~~MGf~~~~a~~AL~~~~w  189 (201)
T 3k9o_A          136 KQNPEMF--------------------------KQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSW  189 (201)
T ss_dssp             HHCHHHH--------------------------HHHHHHHHHHHHCCCCCCHHHHHHHHHHHTTTCCHHHHHHHHHHTTT
T ss_pred             HHCHHHH--------------------------HHHHHHHHHHhcccccccchhHHHHHHHHHcCCCHHHHHHHHHHcCC
Confidence            9999999                          78888888888888877778999999999999999999999999999


Q ss_pred             ChHHHHHHhhC
Q psy17486        162 ELERATEAIFT  172 (172)
Q Consensus       162 ~~~~a~~~l~~  172 (172)
                      |++.|+|+||+
T Consensus       190 d~~~A~e~L~~  200 (201)
T 3k9o_A          190 DVETATELLLS  200 (201)
T ss_dssp             CHHHHHHHHHH
T ss_pred             CHHHHHHHHhc
Confidence            99999999984



>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 7e-23
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 6e-22
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 2e-21
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 8e-21
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 9e-21
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 1e-20
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-20
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 4e-17
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 4e-17
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 7e-17
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-16
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-16
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 1e-15
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 1e-15
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 3e-15
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 3e-15
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 8e-15
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 1e-14
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 7e-14
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 2e-13
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 2e-13
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 2e-13
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 2e-13
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 4e-13
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 4e-13
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 2e-12
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 6e-12
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 1e-11
d1uzxa_152 d.20.1.2 (A:) Vacuolar protein sorting-associated 2e-11
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 6e-09
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 2e-08
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 1e-07
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 3e-05
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 5e-04
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 0.001
d3e46a142 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E 0.001
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 0.002
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), ubch8 [TaxId: 9606]
 Score = 86.8 bits (214), Expect = 7e-23
 Identities = 38/93 (40%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 8   FVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAA 67
             +  +      V F T+I+H NI+S  G ICLDILKD W+ A+T+  VLLS+ +L+   
Sbjct: 56  TFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDC 114

Query: 68  EPDDPQDAVVAKQYKENPEMFTLTARHWTNVYA 100
            P DP    +A QY  N       AR WT  YA
Sbjct: 115 NPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 147


>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.97
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.96
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.96
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.96
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.96
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.96
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.96
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.96
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.95
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.95
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.95
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.95
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.95
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.95
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.94
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.94
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.85
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.83
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.82
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.82
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.8
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.44
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.35
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.2
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 99.19
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 99.04
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 98.61
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 98.61
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 98.57
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 98.37
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 98.13
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.82
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 97.8
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 97.73
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 97.73
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.58
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 97.54
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 97.45
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 97.28
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 96.34
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 96.07
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 95.65
d2k0bx152 Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax 95.31
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 95.11
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 94.14
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 93.65
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 93.64
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 93.61
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 93.09
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 92.12
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 91.43
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 89.47
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 88.25
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 85.96
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 85.17
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 84.11
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 83.42
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 82.87
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.97  E-value=7.5e-32  Score=202.46  Aligned_cols=99  Identities=75%  Similarity=1.139  Sum_probs=92.5

Q ss_pred             CCcEEEEcCCCCCCCCCeeEEecccccccccCCCCceecccCCCCcCCcCCHHHHHHHHHHhhcCCCCCChHHHHHHHHH
Q psy17486          2 VDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQY   81 (172)
Q Consensus         2 ~~~~i~F~p~~YP~~pP~v~F~t~i~HPnV~~~~G~icl~~l~~~W~p~~~l~~vL~~i~~ll~~p~~~~p~n~~aa~~~   81 (172)
                      +..+|.| |++||++||+|+|.|+||||||++.+|.||++++.+.|+|++||.+||.+|+++|.+|++++|+|.+|+++|
T Consensus        56 f~~~i~f-p~~YP~~pP~v~f~t~i~Hpni~~~~g~ic~~~~~~~W~p~~~i~~il~~i~~ll~~p~~~~p~n~eaa~l~  134 (154)
T d2bepa1          56 YQLEIKI-PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQY  134 (154)
T ss_dssp             EEEEEEC-CTTTTSSCCEEEESSCCCBTTBCTTTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCTTSCSCHHHHHHH
T ss_pred             eEEEEec-cccccCCCCcceecccCCCCCeeCCCCccccccccccCCCcCCHHHHHHHHHHHHcCCCCCCchHHHHHHHH
Confidence            4678999 999999999999999999999998799999999999999999999999999999999999999999999999


Q ss_pred             hhCHHHHHHHHHHHHHHHHH
Q psy17486         82 KENPEMFTLTARHWTNVYAG  101 (172)
Q Consensus        82 ~~~~~~f~~~ar~~t~~~a~  101 (172)
                      ++|++.|.++||+||++||+
T Consensus       135 ~~~~~~f~~~a~~~t~k~A~  154 (154)
T d2bepa1         135 KQNPEMFKQTARLWAHVYAG  154 (154)
T ss_dssp             HHCHHHHHHHHHHHHHHHSC
T ss_pred             HHCHHHHHHHHHHHHHHhcC
Confidence            99999997777777777764



>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure