Psyllid ID: psy17486
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 172 | ||||||
| 240848551 | 199 | ubiquitin-conjugating enzyme E2-25kD-lik | 0.761 | 0.658 | 0.675 | 6e-53 | |
| 156553415 | 205 | PREDICTED: ubiquitin-conjugating enzyme | 0.761 | 0.639 | 0.668 | 3e-48 | |
| 383853187 | 199 | PREDICTED: ubiquitin-conjugating enzyme | 0.808 | 0.698 | 0.641 | 9e-48 | |
| 110748673 | 199 | PREDICTED: ubiquitin-conjugating enzyme | 0.808 | 0.698 | 0.635 | 2e-47 | |
| 340715521 | 187 | PREDICTED: ubiquitin-conjugating enzyme | 0.761 | 0.700 | 0.662 | 3e-47 | |
| 427795629 | 232 | Putative ubiquitin-protein ligase, parti | 0.761 | 0.564 | 0.668 | 5e-47 | |
| 346465869 | 242 | hypothetical protein [Amblyomma maculatu | 0.761 | 0.541 | 0.668 | 6e-47 | |
| 260908642 | 169 | ubiquitin protein ligase [Rhipicephalus | 0.761 | 0.775 | 0.656 | 1e-46 | |
| 357631555 | 199 | ubiquitin conjugating enzyme 4 [Danaus p | 0.761 | 0.658 | 0.643 | 3e-46 | |
| 189235252 | 199 | PREDICTED: similar to ubiquitin conjugat | 0.808 | 0.698 | 0.629 | 4e-46 |
| >gi|240848551|ref|NP_001155723.1| ubiquitin-conjugating enzyme E2-25kD-like [Acyrthosiphon pisum] gi|239790683|dbj|BAH71888.1| ACYPI007620 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 211 bits (538), Expect = 6e-53, Method: Compositional matrix adjust.
Identities = 106/157 (67%), Positives = 116/157 (73%), Gaps = 26/157 (16%)
Query: 16 NISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 75
N V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA
Sbjct: 69 NPPKVRFMTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 128
Query: 76 VVAKQYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDF 135
VVAKQYKE PE+F TA HWTN VYAGGP+KN +F
Sbjct: 129 VVAKQYKEYPEIFAKTASHWTN--------------------------VYAGGPNKNSEF 162
Query: 136 DSKIQRLTDMGVMSHDARVALSTYNWELERATEAIFT 172
D+KIQRL DMG+ AR ALSTYNW+LERATE +F+
Sbjct: 163 DTKIQRLIDMGIERDQARGALSTYNWDLERATEQLFS 199
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156553415|ref|XP_001599342.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383853187|ref|XP_003702104.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|110748673|ref|XP_001120470.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis mellifera] gi|340715519|ref|XP_003396259.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like isoform 1 [Bombus terrestris] gi|350406268|ref|XP_003487714.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Bombus impatiens] gi|380012913|ref|XP_003690517.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340715521|ref|XP_003396260.1| PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|427795629|gb|JAA63266.1| Putative ubiquitin-protein ligase, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|346465869|gb|AEO32779.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|260908642|gb|ACX54040.1| ubiquitin protein ligase [Rhipicephalus sanguineus] | Back alignment and taxonomy information |
|---|
| >gi|357631555|gb|EHJ79025.1| ubiquitin conjugating enzyme 4 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|189235252|ref|XP_971328.2| PREDICTED: similar to ubiquitin conjugating enzyme-like protein [Tribolium castaneum] gi|270004126|gb|EFA00574.1| hypothetical protein TcasGA2_TC003444 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 172 | ||||||
| UNIPROTKB|P61085 | 200 | UBE2K "Ubiquitin-conjugating e | 0.563 | 0.485 | 0.767 | 1.9e-35 | |
| UNIPROTKB|E2R6W9 | 200 | UBE2K "Uncharacterized protein | 0.563 | 0.485 | 0.767 | 1.9e-35 | |
| UNIPROTKB|J9NW86 | 200 | UBE2K "Uncharacterized protein | 0.563 | 0.485 | 0.767 | 1.9e-35 | |
| UNIPROTKB|P61086 | 200 | UBE2K "Ubiquitin-conjugating e | 0.563 | 0.485 | 0.767 | 1.9e-35 | |
| UNIPROTKB|Q06AB2 | 200 | UBE2K "Uncharacterized protein | 0.563 | 0.485 | 0.767 | 1.9e-35 | |
| MGI|MGI:1858216 | 200 | Ube2k "ubiquitin-conjugating e | 0.563 | 0.485 | 0.767 | 1.9e-35 | |
| RGD|1311626 | 186 | Ube2k "ubiquitin-conjugating e | 0.563 | 0.521 | 0.767 | 1.9e-35 | |
| ZFIN|ZDB-GENE-980605-9 | 200 | ube2kb "ubiquitin-conjugating | 0.5 | 0.43 | 0.848 | 2.4e-35 | |
| UNIPROTKB|F1NIP7 | 178 | UBE2K "Uncharacterized protein | 0.563 | 0.544 | 0.767 | 2.4e-35 | |
| UNIPROTKB|F1NNF1 | 187 | UBE2K "Uncharacterized protein | 0.563 | 0.518 | 0.767 | 2.4e-35 |
| UNIPROTKB|P61085 UBE2K "Ubiquitin-conjugating enzyme E2 K" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 383 (139.9 bits), Expect = 1.9e-35, P = 1.9e-35
Identities = 76/99 (76%), Positives = 84/99 (84%)
Query: 16 NISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDA 75
N V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQAL+AAAEPDDPQDA
Sbjct: 69 NPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDA 128
Query: 76 VVAKQYKENPEMFTLTARHWTNVYAG--VVAKQYKENPE 112
VVA QYK+NPEMF TAR W +VYAG V + +Y + E
Sbjct: 129 VVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIE 167
|
|
| UNIPROTKB|E2R6W9 UBE2K "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NW86 UBE2K "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61086 UBE2K "Ubiquitin-conjugating enzyme E2 K" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q06AB2 UBE2K "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858216 Ube2k "ubiquitin-conjugating enzyme E2K" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1311626 Ube2k "ubiquitin-conjugating enzyme E2K" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-980605-9 ube2kb "ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIP7 UBE2K "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNF1 UBE2K "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 172 | |||
| pfam00179 | 139 | pfam00179, UQ_con, Ubiquitin-conjugating enzyme | 4e-32 | |
| cd00195 | 141 | cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca | 4e-32 | |
| PTZ00390 | 152 | PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; | 6e-32 | |
| smart00212 | 145 | smart00212, UBCc, Ubiquitin-conjugating enzyme E2, | 5e-30 | |
| COG5078 | 153 | COG5078, COG5078, Ubiquitin-protein ligase [Posttr | 8e-29 | |
| PLN00172 | 147 | PLN00172, PLN00172, ubiquitin conjugating enzyme; | 6e-22 | |
| cd00194 | 38 | cd00194, UBA, Ubiquitin Associated domain | 3e-04 | |
| smart00165 | 37 | smart00165, UBA, Ubiquitin associated domain | 7e-04 |
| >gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme | Back alignment and domain information |
|---|
Score = 111 bits (281), Expect = 4e-32
Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 2/79 (2%)
Query: 19 SVKFLTKIWHPNISSVTGAICLDILKDQ-WAAAMTLRTVLLSLQALMAAAEPDDPQDAVV 77
VKF TKI+HPN+ +G ICLDILKD+ W+ A+T+ VLLS+Q+L++ P+DP +A
Sbjct: 62 KVKFTTKIYHPNVDP-SGEICLDILKDENWSPALTIEQVLLSIQSLLSEPNPEDPLNAEA 120
Query: 78 AKQYKENPEMFTLTARHWT 96
AK Y++N E F R +
Sbjct: 121 AKLYRKNREEFEKKVREYV 139
|
Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139 |
| >gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 172 | |||
| KOG0418|consensus | 200 | 100.0 | ||
| KOG0417|consensus | 148 | 100.0 | ||
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 100.0 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 99.98 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 99.97 | |
| KOG0419|consensus | 152 | 99.97 | ||
| KOG0425|consensus | 171 | 99.96 | ||
| KOG0424|consensus | 158 | 99.96 | ||
| KOG0422|consensus | 153 | 99.95 | ||
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 99.94 | |
| KOG0420|consensus | 184 | 99.94 | ||
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 99.93 | |
| KOG0421|consensus | 175 | 99.93 | ||
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 99.93 | |
| KOG0416|consensus | 189 | 99.92 | ||
| KOG0426|consensus | 165 | 99.91 | ||
| KOG0423|consensus | 223 | 99.86 | ||
| KOG0427|consensus | 161 | 99.6 | ||
| KOG0429|consensus | 258 | 99.36 | ||
| KOG0894|consensus | 244 | 99.17 | ||
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 98.65 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 98.6 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 98.58 | |
| KOG0895|consensus | 1101 | 98.57 | ||
| KOG0428|consensus | 314 | 98.35 | ||
| KOG0897|consensus | 122 | 98.16 | ||
| KOG0895|consensus | 1101 | 98.11 | ||
| PF14461 | 133 | Prok-E2_B: Prokaryotic E2 family B | 98.0 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 97.9 | |
| KOG0896|consensus | 138 | 97.83 | ||
| KOG0011|consensus | 340 | 97.35 | ||
| PF05743 | 121 | UEV: UEV domain; InterPro: IPR008883 The N-termina | 97.23 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 97.09 | |
| KOG2391|consensus | 365 | 96.51 | ||
| KOG0417|consensus | 148 | 96.38 | ||
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 95.78 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 95.58 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 95.06 | |
| KOG0418|consensus | 200 | 94.64 | ||
| KOG0011|consensus | 340 | 94.43 | ||
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 94.04 | |
| KOG0944|consensus | 763 | 91.63 | ||
| KOG2561|consensus | 568 | 88.53 | ||
| PF05773 | 113 | RWD: RWD domain; InterPro: IPR006575 The RWD eukar | 88.22 | |
| PF14457 | 162 | Prok-E2_A: Prokaryotic E2 family A | 88.07 | |
| smart00591 | 107 | RWD domain in RING finger and WD repeat containing | 85.76 | |
| KOG2561|consensus | 568 | 85.18 | ||
| TIGR00264 | 116 | alpha-NAC-related protein. This hypothetical prote | 84.84 | |
| PF08694 | 161 | UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 | 84.82 | |
| PRK06369 | 115 | nac nascent polypeptide-associated complex protein | 83.86 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 83.79 | |
| smart00804 | 63 | TAP_C C-terminal domain of vertebrate Tap protein. | 82.3 | |
| PF06972 | 60 | DUF1296: Protein of unknown function (DUF1296); In | 80.36 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 80.21 | |
| PF03943 | 51 | TAP_C: TAP C-terminal domain; InterPro: IPR005637 | 80.07 |
| >KOG0418|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-45 Score=279.78 Aligned_cols=144 Identities=53% Similarity=0.849 Sum_probs=137.8
Q ss_pred CCcEEEEcCCCCCCCCCeeEEecccccccccCCCCceecccCCCCcCCcCCHHHHHHHHHHhhcCCCCCChHHHHHHHHH
Q psy17486 2 VDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQY 81 (172)
Q Consensus 2 ~~~~i~F~p~~YP~~pP~v~F~t~i~HPnV~~~~G~icl~~l~~~W~p~~~l~~vL~~i~~ll~~p~~~~p~n~~aa~~~ 81 (172)
|...|++ |++|||+||+|+|.|+||||||++.+|.||||||++.|++++||+++|++||++|..|+|.||.++.++++|
T Consensus 55 FeldI~i-Pe~YPF~pPkv~F~TkIwHPnVSs~tGaICLDilkd~Wa~slTlrtvLislQalL~~pEp~dPqDavva~qy 133 (200)
T KOG0418|consen 55 FELDIKI-PENYPFKPPKVKFITKIWHPNVSSQTGAICLDILKDQWAASLTLRTVLISLQALLCAPEPKDPQDAVVAEQY 133 (200)
T ss_pred EEEEEec-CCCCCCCCCceeeeeeeecCCCCcccccchhhhhhcccchhhhHHHHHHHHHHHHcCCCCCChHHHHHHHHH
Confidence 5567888 999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhCHHHHHHHHHHHHHHHHHHHHHhhhcCchhhHHHHHHHHHHhcCCC-CCCCchHHHHHHHHHcCCChHHHHHHHHhcC
Q psy17486 82 KENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGP-SKNPDFDSKIQRLTDMGVMSHDARVALSTYN 160 (172)
Q Consensus 82 ~~~~~~f~~~ar~~t~~~a~~~~~~~~~~~~~~~~~a~~w~~~~~~~~-~~~~~~~~kv~~l~~~gf~~~~a~~aLs~~~ 160 (172)
.+|++.| .++||.||..||+++ ...+...++|+.|.+|||+++.++.+|+..+
T Consensus 134 ~~n~~~F--------------------------~~TAr~WT~~fA~~~~~~~~~~~~~v~~l~~mGf~~~~~i~~L~~~~ 187 (200)
T KOG0418|consen 134 VDNYEMF--------------------------YKTARYWTTEFAGGRLPDDPWDKKKVDSLIEMGFSELEAILVLSGSD 187 (200)
T ss_pred hhhHHHH--------------------------HHHHHHHHHHHhCCCCCCCchhHHHHHHHHHhcccHHHHHHHhhccc
Confidence 9999999 899999999999994 4467899999999999999999999999999
Q ss_pred CChHHHHHHhhC
Q psy17486 161 WELERATEAIFT 172 (172)
Q Consensus 161 W~~~~a~~~l~~ 172 (172)
|+++.|.+.|++
T Consensus 188 w~~~~a~~~~~s 199 (200)
T KOG0418|consen 188 WNLADATEQLLS 199 (200)
T ss_pred cchhhhhHhhcc
Confidence 999999999985
|
|
| >KOG0417|consensus | Back alignment and domain information |
|---|
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0419|consensus | Back alignment and domain information |
|---|
| >KOG0425|consensus | Back alignment and domain information |
|---|
| >KOG0424|consensus | Back alignment and domain information |
|---|
| >KOG0422|consensus | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG0420|consensus | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG0421|consensus | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >KOG0416|consensus | Back alignment and domain information |
|---|
| >KOG0426|consensus | Back alignment and domain information |
|---|
| >KOG0423|consensus | Back alignment and domain information |
|---|
| >KOG0427|consensus | Back alignment and domain information |
|---|
| >KOG0429|consensus | Back alignment and domain information |
|---|
| >KOG0894|consensus | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >KOG0895|consensus | Back alignment and domain information |
|---|
| >KOG0428|consensus | Back alignment and domain information |
|---|
| >KOG0897|consensus | Back alignment and domain information |
|---|
| >KOG0895|consensus | Back alignment and domain information |
|---|
| >PF14461 Prok-E2_B: Prokaryotic E2 family B | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >KOG0896|consensus | Back alignment and domain information |
|---|
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >KOG2391|consensus | Back alignment and domain information |
|---|
| >KOG0417|consensus | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >KOG0418|consensus | Back alignment and domain information |
|---|
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >KOG0944|consensus | Back alignment and domain information |
|---|
| >KOG2561|consensus | Back alignment and domain information |
|---|
| >PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) | Back alignment and domain information |
|---|
| >PF14457 Prok-E2_A: Prokaryotic E2 family A | Back alignment and domain information |
|---|
| >smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
| >KOG2561|consensus | Back alignment and domain information |
|---|
| >TIGR00264 alpha-NAC-related protein | Back alignment and domain information |
|---|
| >PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes | Back alignment and domain information |
|---|
| >PRK06369 nac nascent polypeptide-associated complex protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >smart00804 TAP_C C-terminal domain of vertebrate Tap protein | Back alignment and domain information |
|---|
| >PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 172 | ||||
| 3k9p_A | 217 | The Crystal Structure Of E2-25k And Ubiquitin Compl | 2e-37 | ||
| 1yla_A | 202 | Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington | 2e-37 | ||
| 3k9o_A | 201 | The Crystal Structure Of E2-25k And Ubb+1 Complex L | 2e-37 | ||
| 3e46_A | 253 | Crystal Structure Of Ubiquitin-Conjugating Enzyme E | 1e-36 | ||
| 2bep_A | 159 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 1e-32 | ||
| 2pwq_A | 216 | Crystal Structure Of A Putative Ubiquitin Conjugati | 5e-29 | ||
| 2f4z_A | 193 | Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw | 2e-24 | ||
| 1tte_A | 215 | The Structure Of A Class Ii Ubiquitin-Conjugating E | 9e-24 | ||
| 1fxt_A | 149 | Structure Of A Conjugating Enzyme-Ubiquitin Thioles | 4e-23 | ||
| 2r0j_A | 149 | Crystal Structure Of The Putative Ubiquitin Conjuga | 1e-21 | ||
| 3e95_A | 151 | Crystal Structure Of The Plasmodium Falciparum Ubiq | 2e-21 | ||
| 2c2v_B | 154 | Crystal Structure Of The Chip-Ubc13-Uev1a Complex L | 3e-20 | ||
| 4epo_B | 155 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 3e-20 | ||
| 3von_C | 148 | Crystalstructure Of The Ubiquitin Protease Length = | 3e-20 | ||
| 3hct_B | 155 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 3e-20 | ||
| 1j7d_B | 152 | Crystal Structure Of Hmms2-Hubc13 Length = 152 | 3e-20 | ||
| 4gpr_A | 151 | Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin | 3e-18 | ||
| 4ii2_C | 163 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 1e-17 | ||
| 2ayv_A | 166 | Crystal Structure Of A Putative Ubiquitin-Conjugati | 1e-17 | ||
| 1jat_A | 155 | Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng | 2e-17 | ||
| 1jbb_A | 153 | Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | 2e-17 | ||
| 1qcq_A | 148 | Ubiquitin Conjugating Enzyme Length = 148 | 2e-17 | ||
| 2c4o_B | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 8e-17 | ||
| 3eb6_B | 149 | Structure Of The Ciap2 Ring Domain Bound To Ubch5b | 9e-17 | ||
| 3tgd_A | 152 | Crystal Structure Of The Human Ubiquitin-Conjugatin | 9e-17 | ||
| 1ur6_A | 147 | Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp | 1e-16 | ||
| 2esq_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 1e-16 | ||
| 2esk_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil | 1e-16 | ||
| 2eso_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 1e-16 | ||
| 1z2u_A | 150 | The 1.1a Crystallographic Structure Of Ubiquitin- C | 1e-16 | ||
| 2c4p_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 1e-16 | ||
| 3oj4_A | 153 | Crystal Structure Of The A20 Znf4, Ubiquitin And Ub | 1e-16 | ||
| 2yho_B | 149 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 1e-16 | ||
| 2oxq_A | 152 | Structure Of The Ubch5 :chip U-Box Complex Length = | 1e-16 | ||
| 3l1y_A | 157 | Crystal Structure Of Human Ubc4 E2 Conjugating Enzy | 2e-16 | ||
| 2gmi_A | 152 | Mms2UBC13~UBIQUITIN Length = 152 | 3e-16 | ||
| 1x23_A | 155 | Crystal Structure Of Ubch5c Length = 155 | 4e-16 | ||
| 3rpg_A | 149 | Bmi1RING1B-Ubch5c Complex Structure Length = 149 | 4e-16 | ||
| 3l1z_A | 157 | Crystal Structure Of The U-Box Domain Of Human E4b | 4e-16 | ||
| 2fuh_A | 146 | Solution Structure Of The Ubch5cUB NON-Covalent Com | 4e-16 | ||
| 2esp_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 5e-16 | ||
| 4ddg_A | 399 | Crystal Structure Of Human Otub1UBCH5B~UBUB Length | 1e-15 | ||
| 3a33_A | 150 | Ubch5b~ubiquitin Conjugate Length = 150 | 2e-15 | ||
| 2c4o_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 2e-15 | ||
| 4fh1_A | 153 | S. Cerevisiae Ubc13-N79a Length = 153 | 3e-15 | ||
| 4ap4_B | 153 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 4e-15 | ||
| 3jvz_A | 146 | E2~ubiquitin-Hect Length = 146 | 7e-15 | ||
| 3ugb_A | 147 | Ubch5c~ubiquitin Conjugate Length = 147 | 9e-15 | ||
| 4auq_A | 147 | Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 | 2e-14 | ||
| 3bzh_A | 194 | Crystal Structure Of Human Ubiquitin-Conjugating En | 4e-14 | ||
| 1y6l_A | 149 | Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 | 5e-14 | ||
| 1yh2_A | 169 | Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | 6e-14 | ||
| 1jas_A | 152 | Hsubc2b Length = 152 | 2e-11 | ||
| 1z3d_A | 157 | Protein Crystal Growth Improvement Leading To The 2 | 7e-11 | ||
| 1q34_A | 163 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 7e-11 | ||
| 2e2c_A | 156 | E2-C, An Ubiquitin Conjugating Enzyme Required For | 2e-10 | ||
| 1i7k_A | 179 | Crystal Structure Of Human Mitotic-Specific Ubiquit | 2e-10 | ||
| 2aak_A | 152 | Ubiquitin Conjugating Enzyme From Arabidopsis Thali | 4e-10 | ||
| 2z5d_A | 179 | Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 | 5e-10 | ||
| 1zdn_A | 158 | Ubiquitin-Conjugating Enzyme E2s Length = 158 | 1e-09 | ||
| 1y8x_A | 160 | Structural Basis For Recruitment Of Ubc12 By An E2- | 2e-08 | ||
| 1ayz_A | 169 | Crystal Structure Of The Saccharomyces Cerevisiae U | 1e-07 | ||
| 3o2u_A | 190 | S. Cerevisiae Ubc12 Length = 190 | 1e-07 | ||
| 3sqv_C | 156 | Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L | 3e-07 | ||
| 1c4z_D | 154 | Structure Of E6ap: Insights Into Ubiquitination Pat | 3e-07 | ||
| 2nvu_C | 180 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 6e-07 | ||
| 2onu_A | 152 | Plasmodium Falciparum Ubiquitin Conjugating Enzyme | 6e-07 | ||
| 2awf_A | 172 | Structure Of Human Ubiquitin-Conjugating Enzyme E2 | 5e-06 | ||
| 3ong_B | 159 | Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 | 1e-05 | ||
| 2gjd_A | 157 | Distinct Functional Domains Of Ubc9 Dictate Cell Su | 1e-05 | ||
| 2edi_A | 173 | Solution Structure Of The Uq_con Domain From Human | 2e-05 | ||
| 3fn1_B | 167 | E2-Ring Expansion Of The Nedd8 Cascade Confers Spec | 2e-05 | ||
| 1pzv_A | 164 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 3e-05 | ||
| 1yrv_A | 169 | Novel Ubiquitin-Conjugating Enzyme Length = 169 | 3e-05 | ||
| 2grp_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-Y87a Length | 3e-05 | ||
| 1yf9_A | 171 | Structural Analysis Of Leishmania Major Ubiquitin C | 3e-05 | ||
| 2grn_A | 161 | Crystal Structure Of Human Rangap1-Ubc9 Length = 16 | 6e-05 | ||
| 1u9a_A | 160 | Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 | 6e-05 | ||
| 1kps_A | 159 | Structural Basis For E2-Mediated Sumo Conjugation R | 7e-05 | ||
| 2o25_C | 160 | Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi | 7e-05 | ||
| 3a4s_A | 163 | The Crystal Structure Of The Sld2:ubc9 Complex Leng | 7e-05 | ||
| 1z5s_A | 158 | Crystal Structure Of A Complex Between Ubc9, Sumo-1 | 7e-05 | ||
| 2ob4_A | 180 | Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 | 8e-05 | ||
| 3rz3_A | 183 | Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len | 9e-05 | ||
| 3rcz_B | 163 | Rad60 Sld2 Ubc9 Complex Length = 163 | 2e-04 | ||
| 2gro_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-N85q Length | 3e-04 | ||
| 1wzv_A | 155 | Crystal Structure Of Ubch8 Length = 155 | 6e-04 | ||
| 2kjh_A | 152 | Nmr Based Structural Model Of The Ubch8-Ubiquitin C | 6e-04 |
| >pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 | Back alignment and structure |
|
| >pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 | Back alignment and structure |
| >pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 | Back alignment and structure |
| >pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 | Back alignment and structure |
| >pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 | Back alignment and structure |
| >pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 | Back alignment and structure |
| >pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 | Back alignment and structure |
| >pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 | Back alignment and structure |
| >pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 | Back alignment and structure |
| >pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 | Back alignment and structure |
| >pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 | Back alignment and structure |
| >pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 | Back alignment and structure |
| >pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 | Back alignment and structure |
| >pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 | Back alignment and structure |
| >pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 | Back alignment and structure |
| >pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 | Back alignment and structure |
| >pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 | Back alignment and structure |
| >pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 | Back alignment and structure |
| >pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 | Back alignment and structure |
| >pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 | Back alignment and structure |
| >pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | Back alignment and structure |
| >pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 | Back alignment and structure |
| >pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 | Back alignment and structure |
| >pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 | Back alignment and structure |
| >pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 | Back alignment and structure |
| >pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 | Back alignment and structure |
| >pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 | Back alignment and structure |
| >pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 | Back alignment and structure |
| >pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 | Back alignment and structure |
| >pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 | Back alignment and structure |
| >pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 | Back alignment and structure |
| >pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 | Back alignment and structure |
| >pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 | Back alignment and structure |
| >pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 | Back alignment and structure |
| >pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 | Back alignment and structure |
| >pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 | Back alignment and structure |
| >pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 | Back alignment and structure |
| >pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 | Back alignment and structure |
| >pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 | Back alignment and structure |
| >pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 | Back alignment and structure |
| >pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 | Back alignment and structure |
| >pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 | Back alignment and structure |
| >pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 | Back alignment and structure |
| >pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 | Back alignment and structure |
| >pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 | Back alignment and structure |
| >pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 | Back alignment and structure |
| >pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 | Back alignment and structure |
| >pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | Back alignment and structure |
| >pdb|1JAS|A Chain A, Hsubc2b Length = 152 | Back alignment and structure |
| >pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 | Back alignment and structure |
| >pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 | Back alignment and structure |
| >pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 | Back alignment and structure |
| >pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 | Back alignment and structure |
| >pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 | Back alignment and structure |
| >pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 | Back alignment and structure |
| >pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 | Back alignment and structure |
| >pdb|1Y8X|A Chain A, Structural Basis For Recruitment Of Ubc12 By An E2-Binding Domain In Nedd8's E1 Length = 160 | Back alignment and structure |
| >pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 | Back alignment and structure |
| >pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 | Back alignment and structure |
| >pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 | Back alignment and structure |
| >pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 | Back alignment and structure |
| >pdb|2NVU|C Chain C, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 180 | Back alignment and structure |
| >pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 | Back alignment and structure |
| >pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 | Back alignment and structure |
| >pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 | Back alignment and structure |
| >pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 | Back alignment and structure |
| >pdb|2EDI|A Chain A, Solution Structure Of The Uq_con Domain From Human Nedd8- Conjugating Enzyme Nce2 Length = 173 | Back alignment and structure |
| >pdb|3FN1|B Chain B, E2-Ring Expansion Of The Nedd8 Cascade Confers Specificity To Cullin Modification Length = 167 | Back alignment and structure |
| >pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 | Back alignment and structure |
| >pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 | Back alignment and structure |
| >pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 | Back alignment and structure |
| >pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 | Back alignment and structure |
| >pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 | Back alignment and structure |
| >pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 | Back alignment and structure |
| >pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 | Back alignment and structure |
| >pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 | Back alignment and structure |
| >pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 | Back alignment and structure |
| >pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 | Back alignment and structure |
| >pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 | Back alignment and structure |
| >pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 172 | |||
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 7e-59 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 3e-57 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 2e-54 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 2e-49 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 6e-46 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 5e-44 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 1e-43 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 8e-43 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 2e-42 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 4e-42 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 7e-42 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 2e-41 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 3e-41 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 5e-41 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 5e-41 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 6e-41 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 1e-40 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 2e-40 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 8e-40 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 9e-37 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 1e-36 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 1e-36 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 2e-35 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 2e-35 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 6e-35 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 2e-34 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 2e-34 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 9e-34 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 6e-33 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 3e-31 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 7e-31 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 1e-30 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 2e-30 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 4e-29 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 7e-29 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 2e-28 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 3e-28 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 1e-27 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 2e-26 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 8e-24 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 4e-23 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 1e-22 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 2e-22 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 2e-21 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 8e-21 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 1e-20 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 5e-20 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 8e-20 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 2e-18 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 2e-15 |
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 | Back alignment and structure |
|---|
Score = 181 bits (461), Expect = 7e-59
Identities = 88/153 (57%), Positives = 104/153 (67%), Gaps = 26/153 (16%)
Query: 20 VKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAK 79
V+F+TKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQAL+AAAEPDDPQDA
Sbjct: 74 VRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDA---- 129
Query: 80 QYKENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKI 139
VVA QYK+NPEMF TAR W +VYAG P +P++ KI
Sbjct: 130 ----------------------VVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKI 167
Query: 140 QRLTDMGVMSHDARVALSTYNWELERATEAIFT 172
+ L MG + VALS+ +W++E ATE + +
Sbjct: 168 ENLCAMGFDRNAVIVALSSKSWDVETATELLLS 200
|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 172 | |||
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 100.0 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 100.0 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 100.0 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 100.0 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 99.98 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 99.98 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 99.98 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 99.98 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 99.98 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 99.98 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 99.98 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 99.98 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 99.97 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 99.97 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 99.97 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 99.97 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 99.97 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 99.97 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 99.97 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 99.97 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 99.97 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 99.97 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 99.97 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 99.97 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 99.97 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 99.97 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 99.97 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 99.97 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 99.97 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 99.97 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 99.97 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 99.97 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 99.97 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 99.96 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 99.96 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 99.96 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 99.96 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 99.96 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 99.96 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 99.96 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 99.93 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 99.93 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 99.9 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 99.89 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 99.88 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 99.88 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 99.87 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 99.86 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 99.85 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 99.84 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 99.78 | |
| 3r3q_A | 162 | Suppressor protein STP22 of temperature-sensitive | 99.54 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 99.51 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 99.5 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 99.08 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 98.96 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 98.89 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 98.86 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 98.85 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 98.82 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 98.81 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 98.8 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 98.79 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 98.77 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 98.68 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 98.67 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 98.65 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 98.65 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 98.62 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 98.62 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 98.57 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 98.51 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 98.47 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 98.44 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 98.43 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 98.38 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 98.36 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 98.35 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 98.29 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 98.26 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 98.22 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 98.17 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 98.16 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 98.08 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 98.05 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 98.04 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 97.99 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 97.96 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 97.82 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 97.81 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 97.7 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 97.66 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 97.15 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 96.93 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 96.91 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 96.6 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 96.47 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 96.01 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 95.53 | |
| 1q02_A | 52 | Sequestosome 1; helical bundle, protein binding; N | 95.27 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 95.09 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 94.91 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 94.7 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 94.62 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 94.51 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 94.19 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 92.61 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 92.27 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 88.98 | |
| 4dbg_B | 162 | Ring finger protein 31; ubiquitin fold, ubiquitina | 85.29 | |
| 1tr8_A | 102 | Conserved protein (MTH177); chaperones, nascent po | 85.15 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 84.83 | |
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 84.65 | |
| 2l2d_A | 73 | OTU domain-containing protein 7A; UBA fold, struct | 84.04 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 83.95 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 83.68 | |
| 1oai_A | 59 | Nuclear RNA export factor; nuclear transport, nucl | 83.49 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 82.41 | |
| 2jp7_A | 57 | MRNA export factor MEX67; solution MEX67, UBA, tra | 81.35 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 80.78 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 80.6 | |
| 2daw_A | 154 | RWD domain containing protein 2; alpha+beta sandwi | 80.6 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 80.58 | |
| 1p3q_Q | 54 | VPS9P, vacuolar protein sorting-associated protein | 80.06 |
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
Probab=100.00 E-value=7e-47 Score=298.38 Aligned_cols=144 Identities=63% Similarity=0.993 Sum_probs=137.2
Q ss_pred CCcEEEEcCCCCCCCCCeeEEecccccccccCCCCceecccCCCCcCCcCCHHHHHHHHHHhhcCCCCCChHHHHHHHHH
Q psy17486 2 VDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQY 81 (172)
Q Consensus 2 ~~~~i~F~p~~YP~~pP~v~F~t~i~HPnV~~~~G~icl~~l~~~W~p~~~l~~vL~~i~~ll~~p~~~~p~n~~aa~~~ 81 (172)
+..+|.| |++||++||+|+|.|+||||||++.+|.|||++|.++|+|+++|++||.+|+++|.+|++++|+|.+|+++|
T Consensus 57 f~~~i~f-p~~YP~~pP~v~f~t~i~HPnv~~~~G~iCl~iL~~~W~p~~~i~~vL~~i~~ll~~p~p~~p~n~~aa~~~ 135 (201)
T 3k9o_A 57 YQLEIKI-PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQY 135 (201)
T ss_dssp EEEEEEC-CTTTTTSCCEEEESSCCCBTTBCTTTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCTTSCSCHHHHHHH
T ss_pred EEEEEEC-CCcCCCCCCccccccCcccCCCcCCCCeeeCcccccCCCCCCCHHHHHHHHHHHhcCCCCCCcccHHHHHHH
Confidence 4678888 999999999999999999999996699999999999999999999999999999999999999999999999
Q ss_pred hhCHHHHHHHHHHHHHHHHHHHHHhhhcCchhhHHHHHHHHHHhcCCCCCCCchHHHHHHHHHcCCChHHHHHHHHhcCC
Q psy17486 82 KENPEMFTLTARHWTNVYAGVVAKQYKENPEMFTLTARHWTNVYAGGPSKNPDFDSKIQRLTDMGVMSHDARVALSTYNW 161 (172)
Q Consensus 82 ~~~~~~f~~~ar~~t~~~a~~~~~~~~~~~~~~~~~a~~w~~~~~~~~~~~~~~~~kv~~l~~~gf~~~~a~~aLs~~~W 161 (172)
++|++.| .++||+||++||+++...++++++|+.|++|||++++|+.||+.++|
T Consensus 136 ~~~~~~f--------------------------~~~a~~~~~~~a~~~~~~~~~eekV~~l~~MGf~~~~a~~AL~~~~w 189 (201)
T 3k9o_A 136 KQNPEMF--------------------------KQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSW 189 (201)
T ss_dssp HHCHHHH--------------------------HHHHHHHHHHHHCCCCCCHHHHHHHHHHHTTTCCHHHHHHHHHHTTT
T ss_pred HHCHHHH--------------------------HHHHHHHHHHhcccccccchhHHHHHHHHHcCCCHHHHHHHHHHcCC
Confidence 9999999 78888888888888877778999999999999999999999999999
Q ss_pred ChHHHHHHhhC
Q psy17486 162 ELERATEAIFT 172 (172)
Q Consensus 162 ~~~~a~~~l~~ 172 (172)
|++.|+|+||+
T Consensus 190 d~~~A~e~L~~ 200 (201)
T 3k9o_A 190 DVETATELLLS 200 (201)
T ss_dssp CHHHHHHHHHH
T ss_pred CHHHHHHHHhc
Confidence 99999999984
|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A | Back alignment and structure |
|---|
| >2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 172 | ||||
| d1y6la_ | 148 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 7e-23 | |
| d2bepa1 | 154 | d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 | 6e-22 | |
| d2f4za1 | 161 | d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca | 2e-21 | |
| d1j7db_ | 149 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H | 8e-21 | |
| d1fzya_ | 149 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 9e-21 | |
| d1z2ua1 | 147 | d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U | 1e-20 | |
| d1jata_ | 152 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 2e-20 | |
| d1zdna1 | 151 | d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U | 4e-17 | |
| d1wzva1 | 150 | d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U | 4e-17 | |
| d1pzva_ | 161 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N | 7e-17 | |
| d1ayza_ | 153 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 1e-16 | |
| d2ucza_ | 164 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 5e-16 | |
| d1c4zd_ | 144 | d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H | 1e-15 | |
| d1i7ka_ | 146 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 1e-15 | |
| d1z3da1 | 149 | d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U | 3e-15 | |
| d1yf9a1 | 158 | d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, | 3e-15 | |
| d2f4wa1 | 157 | d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, | 8e-15 | |
| d1y8xa1 | 157 | d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, | 1e-14 | |
| d1yh2a1 | 154 | d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U | 7e-14 | |
| d2z5da1 | 152 | d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, | 2e-13 | |
| d2a7la1 | 117 | d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 | 2e-13 | |
| d1yrva1 | 148 | d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U | 2e-13 | |
| d2a4da1 | 139 | d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, | 2e-13 | |
| d2uyza1 | 156 | d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U | 4e-13 | |
| d2fo3a1 | 109 | d.20.1.1 (A:9-117) Putative ubiquitin-conjugating | 4e-13 | |
| d2e2ca_ | 156 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C | 2e-12 | |
| d2awfa1 | 125 | d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U | 6e-12 | |
| d1jatb_ | 136 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B | 1e-11 | |
| d1uzxa_ | 152 | d.20.1.2 (A:) Vacuolar protein sorting-associated | 2e-11 | |
| d1s1qa_ | 141 | d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 | 6e-09 | |
| d1zuoa1 | 162 | d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme | 2e-08 | |
| d1oqya1 | 41 | a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum | 1e-07 | |
| d1wgna_ | 63 | a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 | 3e-05 | |
| d1wiva_ | 73 | a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress | 5e-04 | |
| d1wjia_ | 63 | a.5.2.1 (A:) Tudor domain containing protein 3, TD | 0.001 | |
| d3e46a1 | 42 | a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E | 0.001 | |
| d1vg5a_ | 73 | a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th | 0.002 |
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Human (Homo sapiens), ubch8 [TaxId: 9606]
Score = 86.8 bits (214), Expect = 7e-23
Identities = 38/93 (40%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
Query: 8 FVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAA 67
+ + V F T+I+H NI+S G ICLDILKD W+ A+T+ VLLS+ +L+
Sbjct: 56 TFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDC 114
Query: 68 EPDDPQDAVVAKQYKENPEMFTLTARHWTNVYA 100
P DP +A QY N AR WT YA
Sbjct: 115 NPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 147
|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 172 | |||
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 99.97 | |
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.96 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 99.96 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 99.96 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.96 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.96 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 99.96 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.96 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.95 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.95 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 99.95 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.95 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.95 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.95 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.94 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 99.94 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 99.85 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 99.83 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.83 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.83 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.82 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 99.82 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.8 | |
| d1uzxa_ | 152 | Vacuolar protein sorting-associated {Baker's yeast | 99.44 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 99.35 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 99.2 | |
| d3e46a1 | 42 | Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal | 99.19 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 99.04 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 98.61 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 98.61 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 98.57 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 98.37 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 98.13 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.82 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 97.8 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 97.73 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 97.73 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 97.65 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 97.58 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 97.54 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 97.45 | |
| d1oqya2 | 44 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 97.28 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 96.34 | |
| d2cosa1 | 41 | Serine/threonine protein kinase LATS2 {Mouse (Mus | 96.07 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 95.65 | |
| d2k0bx1 | 52 | Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax | 95.31 | |
| d1vega_ | 83 | NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu | 95.11 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 94.14 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 93.65 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 93.64 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 93.61 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 93.09 | |
| d1mn3a_ | 54 | Vacuolar protein sorting-associated protein vps9 { | 92.12 | |
| d2cp8a1 | 41 | Migration-inducing protein 19 NBR1 {Human (Homo sa | 91.43 | |
| d2dkla1 | 72 | Trinucleotide repeat containing 6c protein, TNRC6C | 89.47 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 88.25 | |
| d2daya1 | 115 | E3 ubiquitin-protein ligase RNF25 {Human (Homo sap | 85.96 | |
| d2dawa1 | 141 | RWD domain-containing protein 2 {Human (Homo sapie | 85.17 | |
| d1oaia_ | 59 | FG-binding, C-terminal domain of TAP {Human (Homo | 84.11 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 83.42 | |
| d2in1a1 | 162 | Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie | 82.87 |
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.97 E-value=7.5e-32 Score=202.46 Aligned_cols=99 Identities=75% Similarity=1.139 Sum_probs=92.5
Q ss_pred CCcEEEEcCCCCCCCCCeeEEecccccccccCCCCceecccCCCCcCCcCCHHHHHHHHHHhhcCCCCCChHHHHHHHHH
Q psy17486 2 VDTTVKFVTKIWHPNISSVKFLTKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALMAAAEPDDPQDAVVAKQY 81 (172)
Q Consensus 2 ~~~~i~F~p~~YP~~pP~v~F~t~i~HPnV~~~~G~icl~~l~~~W~p~~~l~~vL~~i~~ll~~p~~~~p~n~~aa~~~ 81 (172)
+..+|.| |++||++||+|+|.|+||||||++.+|.||++++.+.|+|++||.+||.+|+++|.+|++++|+|.+|+++|
T Consensus 56 f~~~i~f-p~~YP~~pP~v~f~t~i~Hpni~~~~g~ic~~~~~~~W~p~~~i~~il~~i~~ll~~p~~~~p~n~eaa~l~ 134 (154)
T d2bepa1 56 YQLEIKI-PETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQY 134 (154)
T ss_dssp EEEEEEC-CTTTTSSCCEEEESSCCCBTTBCTTTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCTTSCSCHHHHHHH
T ss_pred eEEEEec-cccccCCCCcceecccCCCCCeeCCCCccccccccccCCCcCCHHHHHHHHHHHHcCCCCCCchHHHHHHHH
Confidence 4678999 999999999999999999999998799999999999999999999999999999999999999999999999
Q ss_pred hhCHHHHHHHHHHHHHHHHH
Q psy17486 82 KENPEMFTLTARHWTNVYAG 101 (172)
Q Consensus 82 ~~~~~~f~~~ar~~t~~~a~ 101 (172)
++|++.|.++||+||++||+
T Consensus 135 ~~~~~~f~~~a~~~t~k~A~ 154 (154)
T d2bepa1 135 KQNPEMFKQTARLWAHVYAG 154 (154)
T ss_dssp HHCHHHHHHHHHHHHHHHSC
T ss_pred HHCHHHHHHHHHHHHHHhcC
Confidence 99999997777777777764
|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|