Diaphorina citri psyllid: psy17504

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------

MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN

cccccccEEEEEccccEEcccccccccccccccccEEEEEccCEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccc

MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPA*************************SEDINANVMRIPSTTLEMLHS**********************************************************KDLKQLAQKTGLSKRVL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030154 [BP]	cell differentiation	probable	GO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 2-54
View the alignment between query and template
View the model in PyMOL

Template: 2DA1, chain A
Confidence level:very confident
Coverage over the Query: 147-195
View the alignment between query and template
View the model in PyMOL