Psyllid ID: psy17504


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN
cccccccEEEEEccccEEcccccccccccccccccEEEEEccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccc
ccccHHHHHHHHHccEEEEccEEEHHHccccccccEEEEEcccEEEHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHEEcc
MGISSSELVMRARDLVFHLHCFTciscgilltkgdlfgmrdemiycrphyeilrhrdycgsaeieqpmsprpapwqpttvqkgrprkrklsvdsptppsedinanvmripsttlemlhsgdlsssmeslsyesgagnsspgsgvhshqrtkRMRTSFKHHQLRTMKSYFninqnpdakdLKQLAQktglskrvlqn
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEieqpmsprpapwqpttvqkgrprkrklsvdsptppsedinanvMRIPSTTLEMLHSGDLSSSMESLSYESGagnsspgsgvhshqRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKqlaqktglskrvlqn
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHsgdlsssmeslsyesgAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN
********VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGS***************************************************************************************************************************************
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDL*******************************************************KDLKQLAQKTGLSKRVL**
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPA*************************SEDINANVMRIPSTTLEMLHS************************************SFKHHQLRTMKSYFNINQNPDAKDLKQLAQKT*********
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHR************************************************************************************************MRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query196 2.2.26 [Sep-21-2011]
Q9Z0S2406 LIM/homeobox protein Lhx2 yes N/A 0.846 0.408 0.475 1e-41
P50458406 LIM/homeobox protein Lhx2 yes N/A 0.867 0.418 0.470 2e-41
P36198 426 LIM/homeobox protein Lhx2 no N/A 0.867 0.399 0.472 3e-41
Q80W90388 LIM/homeobox protein Lhx9 no N/A 0.867 0.438 0.5 7e-41
A0JNI8397 LIM/homeobox protein Lhx9 no N/A 0.867 0.428 0.5 1e-40
Q9NQ69397 LIM/homeobox protein Lhx9 no N/A 0.867 0.428 0.5 1e-40
A2I8Z7377 LIM/homeobox protein Lhx9 N/A N/A 0.867 0.450 0.495 2e-40
Q9WUH2397 LIM/homeobox protein Lhx9 no N/A 0.867 0.428 0.5 2e-40
Q1LWV4396 LIM/homeobox protein Lhx9 no N/A 0.867 0.429 0.49 2e-40
Q90881397 LIM/homeobox protein Lhx9 no N/A 0.867 0.428 0.485 4e-39
>sp|Q9Z0S2|LHX2_MOUSE LIM/homeobox protein Lhx2 OS=Mus musculus GN=Lhx2 PE=1 SV=1 Back     alignment and function desciption
 Score =  169 bits (428), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 126/221 (57%), Gaps = 55/221 (24%)

Query: 1   MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDY-- 58
           +GIS+SE+VMRARDLV+HL+CFTC +C  +LT GD FGM+D ++YCR H+E L   +Y  
Sbjct: 120 LGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPA 179

Query: 59  ---------------------CGSAEIEQPMSPRPAPWQPT--TVQKGRPRKRKLSVDSP 95
                                 GSA      +P   P+     TVQKGRPRKRK    SP
Sbjct: 180 HFNHADVAAAAAAAAAAKSAGLGSAGA----NPLGLPYYNGVGTVQKGRPRKRK----SP 231

Query: 96  TPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSY-ESGAGNSSPGSGVHSHQRTKRMR 154
            P                       DL++   +LS  E+ A +        S Q+TKRMR
Sbjct: 232 GP---------------------GADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMR 270

Query: 155 TSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195
           TSFKHHQLRTMKSYF IN NPDAKDLKQLAQKTGL+KRVLQ
Sbjct: 271 TSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 311




Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.
Mus musculus (taxid: 10090)
>sp|P50458|LHX2_HUMAN LIM/homeobox protein Lhx2 OS=Homo sapiens GN=LHX2 PE=2 SV=2 Back     alignment and function description
>sp|P36198|LHX2_RAT LIM/homeobox protein Lhx2 OS=Rattus norvegicus GN=Lhx2 PE=2 SV=1 Back     alignment and function description
>sp|Q80W90|LHX9_RAT LIM/homeobox protein Lhx9 OS=Rattus norvegicus GN=Lhx9 PE=2 SV=1 Back     alignment and function description
>sp|A0JNI8|LHX9_BOVIN LIM/homeobox protein Lhx9 OS=Bos taurus GN=LHX9 PE=2 SV=2 Back     alignment and function description
>sp|Q9NQ69|LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens GN=LHX9 PE=1 SV=3 Back     alignment and function description
>sp|A2I8Z7|LHX9_ASTFA LIM/homeobox protein Lhx9 OS=Astyanax fasciatus GN=lhx9 PE=2 SV=1 Back     alignment and function description
>sp|Q9WUH2|LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus GN=Lhx9 PE=1 SV=3 Back     alignment and function description
>sp|Q1LWV4|LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio GN=lhx9 PE=2 SV=1 Back     alignment and function description
>sp|Q90881|LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus GN=LHX9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
357622661 359 apterous [Danaus plexippus] 0.959 0.523 0.608 2e-59
380690603231 apterous, partial [Cydia pomonella] 0.918 0.779 0.641 7e-59
328925124 349 apterous B alpha [Bombyx mori] 0.954 0.535 0.603 2e-57
225543484 361 apterous [Tribolium castaneum] gi|224459 0.933 0.506 0.607 8e-57
328787166 390 PREDICTED: LIM/homeobox protein Lhx9-lik 0.938 0.471 0.603 1e-56
383850874 391 PREDICTED: LIM/homeobox protein Lhx9-lik 0.938 0.470 0.603 4e-56
380027052 390 PREDICTED: LIM/homeobox protein Lhx9-lik 0.948 0.476 0.609 8e-56
242023961 383 LIM/homeobox protein Lhx2, putative [Ped 0.948 0.485 0.589 2e-55
350404759 441 PREDICTED: LIM/homeobox protein Lhx9-lik 0.938 0.417 0.594 4e-55
340721020 391 PREDICTED: LIM/homeobox protein Lhx9-lik 0.938 0.470 0.594 5e-55
>gi|357622661|gb|EHJ74087.1| apterous [Danaus plexippus] Back     alignment and taxonomy information
 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 149/202 (73%), Gaps = 14/202 (6%)

Query: 2   GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYC-- 59
           GI+++ELVMRARD+VFHL CFTC++CG LL+KGD+FGMR+ ++YCRPHY+ +   D+C  
Sbjct: 86  GITANELVMRARDMVFHLTCFTCVACGTLLSKGDVFGMRNSLVYCRPHYDSVCMDDFCEE 145

Query: 60  --GSAEIEQPMSPR---PAPWQPTTV-QKGRPRKRKLSVDSPTPPSEDINANVMRIPSTT 113
              S    Q ++     P  + P  V QKGRPRKRK++      P ED+    MR+ ST 
Sbjct: 146 DVNSVYRCQELNSEGDSPNQYFPVGVNQKGRPRKRKIA----HGPHEDMQVQTMRMASTA 201

Query: 114 LEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQ 173
           L++LH  DLSSSMESL+Y+S    +SPGS     QRTKRMRTSFKHHQLRTMKSYF INQ
Sbjct: 202 LDILHRADLSSSMESLAYDSSV--ASPGSVSSHTQRTKRMRTSFKHHQLRTMKSYFAINQ 259

Query: 174 NPDAKDLKQLAQKTGLSKRVLQ 195
           NPDAKDLKQLAQKTGLSKRVLQ
Sbjct: 260 NPDAKDLKQLAQKTGLSKRVLQ 281




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380690603|gb|AFD93370.1| apterous, partial [Cydia pomonella] Back     alignment and taxonomy information
>gi|328925124|dbj|BAK19077.1| apterous B alpha [Bombyx mori] Back     alignment and taxonomy information
>gi|225543484|ref|NP_001139388.1| apterous [Tribolium castaneum] gi|224459214|gb|ACN43342.1| apterous b [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328787166|ref|XP_003250891.1| PREDICTED: LIM/homeobox protein Lhx9-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383850874|ref|XP_003700999.1| PREDICTED: LIM/homeobox protein Lhx9-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380027052|ref|XP_003697250.1| PREDICTED: LIM/homeobox protein Lhx9-like [Apis florea] Back     alignment and taxonomy information
>gi|242023961|ref|XP_002432399.1| LIM/homeobox protein Lhx2, putative [Pediculus humanus corporis] gi|212517822|gb|EEB19661.1| LIM/homeobox protein Lhx2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350404759|ref|XP_003487211.1| PREDICTED: LIM/homeobox protein Lhx9-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721020|ref|XP_003398925.1| PREDICTED: LIM/homeobox protein Lhx9-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query196
UNIPROTKB|E1BM14406 LHX2 "Uncharacterized protein" 0.255 0.123 0.9 3.6e-43
UNIPROTKB|E2RPC3406 LHX2 "Uncharacterized protein" 0.255 0.123 0.9 3.6e-43
UNIPROTKB|P50458406 LHX2 "LIM/homeobox protein Lhx 0.255 0.123 0.9 3.6e-43
UNIPROTKB|C4TJC6406 Lhx2 "LIM homeobox protein 2" 0.255 0.123 0.9 3.6e-43
MGI|MGI:96785406 Lhx2 "LIM homeobox protein 2" 0.255 0.123 0.9 3.6e-43
UNIPROTKB|D4A380406 Lhx2 "LIM/homeobox protein Lhx 0.255 0.123 0.9 3.6e-43
UNIPROTKB|H7C0H1412 LHX2 "LIM/homeobox protein Lhx 0.255 0.121 0.9 4.4e-43
UNIPROTKB|G3N0G6 427 LHX2 "Uncharacterized protein" 0.255 0.117 0.9 6.6e-43
RGD|71076 426 Lhx2 "LIM homeobox 2" [Rattus 0.255 0.117 0.9 8.1e-43
UNIPROTKB|P36198 426 Lhx2 "LIM/homeobox protein Lhx 0.255 0.117 0.9 8.1e-43
UNIPROTKB|E1BM14 LHX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 230 (86.0 bits), Expect = 3.6e-43, Sum P(3) = 3.6e-43
 Identities = 45/50 (90%), Positives = 47/50 (94%)

Query:   146 SHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195
             S Q+TKRMRTSFKHHQLRTMKSYF IN NPDAKDLKQLAQKTGL+KRVLQ
Sbjct:   262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 311


GO:0005634 "nucleus" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
UNIPROTKB|E2RPC3 LHX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P50458 LHX2 "LIM/homeobox protein Lhx2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C4TJC6 Lhx2 "LIM homeobox protein 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:96785 Lhx2 "LIM homeobox protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A380 Lhx2 "LIM/homeobox protein Lhx2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H7C0H1 LHX2 "LIM/homeobox protein Lhx2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3N0G6 LHX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|71076 Lhx2 "LIM homeobox 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P36198 Lhx2 "LIM/homeobox protein Lhx2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 1e-30
cd0947459 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 2e-20
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 2e-18
pfam0041258 pfam00412, LIM, LIM domain 4e-14
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 3e-13
cd0937955 cd09379, LIM2_AWH, The second LIM domain of Arrowh 1e-12
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-12
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 2e-12
smart0038957 smart00389, HOX, Homeodomain 3e-12
cd0947155 cd09471, LIM2_Isl2, The second LIM domain of Isl2 3e-12
cd0937556 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of 2e-11
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-11
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 3e-11
cd0937455 cd09374, LIM2_Isl, The second LIM domain of Isl, a 4e-11
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 7e-11
cd0947257 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 2e-09
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 2e-09
cd0938255 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 3e-09
cd0938955 cd09389, LIM2_LMO1_LMO3, The second LIM domain of 4e-09
cd0938355 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of 7e-09
cd0947356 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 1e-08
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 1e-07
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 1e-05
cd0938556 cd09385, LIM2_LMO2, The second LIM domain of LMO2 3e-05
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 9e-05
cd0945153 cd09451, LIM_RIL, The LIM domain of RIL 9e-05
cd0936554 cd09365, LIM2_LIMK, The second LIM domain of LIMK 2e-04
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 5e-04
cd0946455 cd09464, LIM2_LIMK1, The second LIM domain of LIMK 6e-04
cd0936655 cd09366, LIM1_Isl, The first LIM domain of Isl, a 0.001
cd0948653 cd09486, LIM_Eplin_like_1, a LIM domain subfamily 0.001
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 0.001
cd0941458 cd09414, LIM1_LIMPETin, The first LIM domain of pr 0.001
cd0939253 cd09392, LIM2_Lrg1p_like, The second LIM domain of 0.004
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 0.004
cd0932653 cd09326, LIM_CRP_like, The LIM domains of Cysteine 0.004
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
 Score =  106 bits (266), Expect = 1e-30
 Identities = 37/50 (74%), Positives = 43/50 (86%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +GIS+SELVMRARDLVFHL+CFTC +C   LTKGD FGMRD ++YCR HY
Sbjct: 10 LGISASELVMRARDLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCRLHY 59


The second LIM domain of Lhx2 and Lhx9 family: Lhx2 and Lhx9 are highly homologous LHX regulatory proteins. They belong to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. Although Lhx2 and Lhx9 are highly homologous, they seems to play regulatory roles in different organs. In animals, Lhx2 plays important roles in eye, cerebral cortex, limb, the olfactory organs, and erythrocyte development. Lhx2 gene knockout mice exhibit impaired patterning of the cortical hem and the telencephalon of the developing brain, and a lack of development in olfactory structures. Lhx9 is expressed in several regions of the developing mouse brain, the spinal cord, the pancreas, in limb mesenchyme, and in the urogenital region. Lhx9 plays critical roles in gonad development. Homozygous mice lacking functional Lhx9 alleles exhibit numerous urogenital defects, such as gonadal agenesis, infertility, and undetectable levels of testosterone and estradiol coupled with high FSH levels. Lhx9 null mice are phenotypically female, even those that are genotypically male. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 59

>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 Back     alignment and domain information
>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL Back     alignment and domain information
>gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of proteins with unknown function Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 196
KOG4577|consensus 383 99.82
KOG0484|consensus125 99.21
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.05
KOG2251|consensus 228 99.0
KOG0490|consensus 235 98.96
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 98.94
KOG0850|consensus245 98.9
KOG0488|consensus309 98.85
KOG0843|consensus197 98.81
KOG0489|consensus261 98.78
KOG0485|consensus 268 98.78
KOG0494|consensus 332 98.75
KOG0842|consensus 307 98.74
KOG1701|consensus468 98.73
KOG0486|consensus 351 98.73
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.72
KOG1701|consensus468 98.59
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.57
KOG0493|consensus342 98.51
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.42
KOG0492|consensus246 98.35
KOG0490|consensus235 98.32
KOG0487|consensus308 98.27
KOG2272|consensus 332 98.22
KOG0848|consensus317 98.13
KOG0491|consensus194 98.1
KOG4577|consensus 383 98.07
KOG0849|consensus 354 97.97
KOG0844|consensus 408 97.92
KOG2272|consensus332 97.87
COG5576156 Homeodomain-containing transcription factor [Trans 97.64
KOG1703|consensus479 97.63
KOG3802|consensus398 97.62
KOG1044|consensus 670 97.45
KOG2252|consensus558 97.32
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 97.29
KOG1044|consensus 670 96.89
KOG1702|consensus264 96.81
KOG1168|consensus385 96.32
KOG1700|consensus200 96.32
KOG0483|consensus 198 96.29
KOG0847|consensus288 96.07
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 95.66
KOG1700|consensus200 95.27
KOG0775|consensus304 93.68
KOG0774|consensus334 91.84
KOG1146|consensus 1406 89.32
KOG1703|consensus479 87.75
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 84.38
>KOG4577|consensus Back     alignment and domain information
Probab=99.82  E-value=8e-21  Score=157.29  Aligned_cols=112  Identities=36%  Similarity=0.670  Sum_probs=95.8

Q ss_pred             CCCChHHHHHHHHhHHHhhhhhhhhhhcceeccCCcccc-ccceeeeccchhhhhhccccCcccccCCCCCCCCCCCCcc
Q psy17504          1 MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGM-RDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTT   79 (196)
Q Consensus         1 ~~i~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~G~~f~~-~~~~~~C~~~y~~~~~~~~~~~~~~~~~~~p~~~~~~~~~   79 (196)
                      +||.|+..|.+|.+.+||+.||.|++|+++|.+|++|++ .++++.|+.||+....-..                     
T Consensus       100 ~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~---------------------  158 (383)
T KOG4577|consen  100 EGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHC---------------------  158 (383)
T ss_pred             CCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhccc---------------------
Confidence            589999999999999999999999999999999999965 6789999999986532100                     


Q ss_pred             cccCCcccccccccCCCCCccccccceeeccccchhhhccCCccccccccccccCCCCCCCCCccccccccchhhcccch
Q psy17504         80 VQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKH  159 (196)
Q Consensus        80 ~~~g~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gs~~~~~~k~rR~RT~ft~  159 (196)
                                                      .                 .+++  +           ...||+||++|+
T Consensus       159 --------------------------------~-----------------~l~g--d-----------~~nKRPRTTItA  176 (383)
T KOG4577|consen  159 --------------------------------N-----------------ELEG--D-----------ASNKRPRTTITA  176 (383)
T ss_pred             --------------------------------c-----------------cccc--c-----------cccCCCcceeeH
Confidence                                            0                 0111  0           124789999999


Q ss_pred             hhHhhhhhhhcccCCCChHHHHHHHHHhCcchhhhc
Q psy17504        160 HQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ  195 (196)
Q Consensus       160 ~Ql~~L~~~F~~~~~p~~~~r~~La~~lgL~~~~Vq  195 (196)
                      .||+.|+.+|...+.|.++.||+|+..+||..++||
T Consensus       177 KqLETLK~AYn~SpKPARHVREQLsseTGLDMRVVQ  212 (383)
T KOG4577|consen  177 KQLETLKQAYNTSPKPARHVREQLSSETGLDMRVVQ  212 (383)
T ss_pred             HHHHHHHHHhcCCCchhHHHHHHhhhccCcceeehh
Confidence            999999999999999999999999999999999997



>KOG0484|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 1e-18
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 2e-07
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 4e-07
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 1e-06
2da1_A70 Solution Structure Of The First Homeobox Domain Of 6e-05
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 2e-04
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 2e-04
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure

Iteration: 1

Score = 89.4 bits (220), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 42/45 (93%), Positives = 43/45 (95%) Query: 151 KRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195 KRMRTSFKHHQLRTMKSYF IN NPDAKDLKQLAQKTGL+KRVLQ Sbjct: 8 KRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 52
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|2DA1|A Chain A, Solution Structure Of The First Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query196
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 2e-21
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-21
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-19
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 3e-19
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 6e-09
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 4e-19
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-07
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 5e-19
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-06
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 9e-19
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-17
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-17
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-16
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 5e-07
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-16
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-15
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-14
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-12
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-12
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-08
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 4e-12
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 6e-12
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-11
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-11
3f6q_B72 LIM and senescent cell antigen-like-containing dom 4e-11
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 9e-11
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-10
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 7e-10
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 1e-09
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-09
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 5e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-09
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 3e-09
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-09
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 8e-09
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 9e-09
2cuq_A80 Four and A half LIM domains 3; structural genomics 1e-08
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-08
2e19_A64 Transcription factor 8; homeobox domain, structura 1e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-08
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-08
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 3e-08
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 4e-08
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 5e-08
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 5e-08
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 8e-08
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 8e-05
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 1e-07
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-07
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-07
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 3e-07
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 3e-07
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-07
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 4e-07
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 5e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 5e-07
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 5e-07
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 5e-07
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 6e-07
2co8_A82 NEDD9 interacting protein with calponin homology a 7e-07
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 2e-06
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-06
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 3e-05
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-06
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 3e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-05
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 7e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 1e-04
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-04
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-04
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-04
1wh5_A80 ZF-HD homeobox family protein; structural genomics 3e-04
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-04
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 4e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 6e-04
2cor_A79 Pinch protein; LIM domain, particularly interestin 7e-04
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.38
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.29
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.25
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.25
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.23
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.23
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.16
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.15
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.15
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.13
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.13
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.12
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.1
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.09
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.08
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.08
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.08
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.06
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.06
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.04
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.03
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.03
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.02
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.02
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.02
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.02
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.01
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.01
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.0
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 98.99
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 98.99
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 98.99
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 98.98
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 98.97
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 98.97
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 98.97
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 98.97
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 98.96
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 98.96
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 98.95
2co8_A82 NEDD9 interacting protein with calponin homology a 98.95
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 98.95
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 98.95
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 98.94
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 98.93
3a01_A93 Homeodomain-containing protein; homeodomain, prote 98.93
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 98.92
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 98.91
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 98.9
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 98.9
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 98.9
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 98.9
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 98.88
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 98.88
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 98.88
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 98.87
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 98.87
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 98.86
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 98.85
3a02_A60 Homeobox protein aristaless; homeodomain, developm 98.85
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 98.85
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 98.84
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 98.84
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 98.84
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 98.84
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 98.84
1lfb_A99 Liver transcription factor (LFB1); transcription r 98.83
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 98.83
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 98.82
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 98.81
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 98.8
1uhs_A72 HOP, homeodomain only protein; structural genomics 98.8
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 98.79
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 98.79
2cuq_A80 Four and A half LIM domains 3; structural genomics 98.78
2cor_A79 Pinch protein; LIM domain, particularly interestin 98.78
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 98.77
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 98.76
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 98.76
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 98.75
1e3o_C160 Octamer-binding transcription factor 1; transcript 98.75
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 98.75
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 98.75
3d1n_I151 POU domain, class 6, transcription factor 1; prote 98.74
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 98.74
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 98.74
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 98.74
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 98.73
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 98.73
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 98.73
2xsd_C164 POU domain, class 3, transcription factor 1; trans 98.72
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 98.67
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.67
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.66
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.65
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 98.63
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 98.6
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.57
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 98.56
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 98.56
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 98.54
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 98.54
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.53
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 98.52
2e19_A64 Transcription factor 8; homeobox domain, structura 98.46
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 98.45
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.44
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.44
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 98.43
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.4
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 98.29
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.25
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 98.25
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 98.24
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.16
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.14
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 97.84
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 97.53
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 93.11
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 92.67
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 81.44
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
Probab=99.38  E-value=6.8e-15  Score=114.64  Aligned_cols=53  Identities=43%  Similarity=0.943  Sum_probs=46.0

Q ss_pred             CCChHHHHHHHHhHHHhhhhhhhhhhcceeccCCccc-cccceeeeccchhhhh
Q psy17504          2 GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFG-MRDEMIYCRPHYEILR   54 (196)
Q Consensus         2 ~i~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~G~~f~-~~~~~~~C~~~y~~~~   54 (196)
                      .|.+.++|++|.+..||..||+|..|+++|..|+.|+ +.++++||+.||..++
T Consensus        74 ~I~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~g~~~C~~c~~~~~  127 (169)
T 2rgt_A           74 GIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK  127 (169)
T ss_dssp             BCCTTSEEEEETTEEEEGGGCBCTTTCCBCCTTCEEEECTTSCEEEHHHHHHHH
T ss_pred             ccCCCcEEEEcCCceEeeCCCcCCCCCCCCCCCCceEEccCCeEECHHHHHHHh
Confidence            4666677888999999999999999999997788875 4689999999998765



>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 196
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 5e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-09
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-09
d1rutx331 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus 1e-08
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-08
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 5e-08
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-08
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-07
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 4e-07
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 5e-07
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 5e-07
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 5e-07
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 8e-07
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 9e-07
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-06
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-06
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-06
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-06
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 6e-06
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-06
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 7e-06
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-06
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 9e-06
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-05
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-05
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-04
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 4e-04
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 7e-04
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 0.002
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 0.004
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 51.8 bits (124), Expect = 5e-10
 Identities = 10/59 (16%), Positives = 26/59 (44%)

Query: 138 SSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN 196
           ++P +     + T++ R  +  HQ   ++  F  N         ++A+   L++R ++ 
Sbjct: 1   NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKI 59


>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query196
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.22
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.21
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.2
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.19
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.19
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.18
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.18
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.16
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.15
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.15
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.14
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.11
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.11
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.1
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.08
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.08
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.05
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.05
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.02
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 98.95
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 98.92
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 98.9
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 98.85
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 98.79
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.69
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.52
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.51
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.51
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.44
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.3
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.29
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.27
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.24
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.19
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.95
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.77
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 97.76
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.71
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.56
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.25
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.13
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.09
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.87
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 96.73
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 96.59
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.56
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.54
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 96.5
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.48
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 95.98
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.83
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 94.64
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 94.24
d2co8a133 Nedd9 interacting protein with calponin homology, 93.75
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 92.63
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 90.73
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 90.36
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 89.78
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 89.06
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 88.32
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 87.96
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 87.35
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 86.94
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 85.36
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 80.3
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: VND/NK-2 protein
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.22  E-value=3e-12  Score=85.82  Aligned_cols=49  Identities=16%  Similarity=0.244  Sum_probs=46.0

Q ss_pred             ccccchhhcccchhhHhhhhhhhcccCCCChHHHHHHHHHhCcchhhhc
Q psy17504        147 HQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ  195 (196)
Q Consensus       147 ~~k~rR~RT~ft~~Ql~~L~~~F~~~~~p~~~~r~~La~~lgL~~~~Vq  195 (196)
                      ..+.||.||.||.+|+.+|+..|+.++||+...+++||..+||++.+|+
T Consensus         6 p~k~rr~Rt~ft~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qV~   54 (77)
T d1vnda_           6 PNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVK   54 (77)
T ss_dssp             SSSSCSSCCCCCTTHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhhhh
Confidence            3466778999999999999999999999999999999999999999997



>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure