Psyllid ID: psy17504
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| 357622661 | 359 | apterous [Danaus plexippus] | 0.959 | 0.523 | 0.608 | 2e-59 | |
| 380690603 | 231 | apterous, partial [Cydia pomonella] | 0.918 | 0.779 | 0.641 | 7e-59 | |
| 328925124 | 349 | apterous B alpha [Bombyx mori] | 0.954 | 0.535 | 0.603 | 2e-57 | |
| 225543484 | 361 | apterous [Tribolium castaneum] gi|224459 | 0.933 | 0.506 | 0.607 | 8e-57 | |
| 328787166 | 390 | PREDICTED: LIM/homeobox protein Lhx9-lik | 0.938 | 0.471 | 0.603 | 1e-56 | |
| 383850874 | 391 | PREDICTED: LIM/homeobox protein Lhx9-lik | 0.938 | 0.470 | 0.603 | 4e-56 | |
| 380027052 | 390 | PREDICTED: LIM/homeobox protein Lhx9-lik | 0.948 | 0.476 | 0.609 | 8e-56 | |
| 242023961 | 383 | LIM/homeobox protein Lhx2, putative [Ped | 0.948 | 0.485 | 0.589 | 2e-55 | |
| 350404759 | 441 | PREDICTED: LIM/homeobox protein Lhx9-lik | 0.938 | 0.417 | 0.594 | 4e-55 | |
| 340721020 | 391 | PREDICTED: LIM/homeobox protein Lhx9-lik | 0.938 | 0.470 | 0.594 | 5e-55 |
| >gi|357622661|gb|EHJ74087.1| apterous [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 233 bits (595), Expect = 2e-59, Method: Compositional matrix adjust.
Identities = 123/202 (60%), Positives = 149/202 (73%), Gaps = 14/202 (6%)
Query: 2 GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYC-- 59
GI+++ELVMRARD+VFHL CFTC++CG LL+KGD+FGMR+ ++YCRPHY+ + D+C
Sbjct: 86 GITANELVMRARDMVFHLTCFTCVACGTLLSKGDVFGMRNSLVYCRPHYDSVCMDDFCEE 145
Query: 60 --GSAEIEQPMSPR---PAPWQPTTV-QKGRPRKRKLSVDSPTPPSEDINANVMRIPSTT 113
S Q ++ P + P V QKGRPRKRK++ P ED+ MR+ ST
Sbjct: 146 DVNSVYRCQELNSEGDSPNQYFPVGVNQKGRPRKRKIA----HGPHEDMQVQTMRMASTA 201
Query: 114 LEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQ 173
L++LH DLSSSMESL+Y+S +SPGS QRTKRMRTSFKHHQLRTMKSYF INQ
Sbjct: 202 LDILHRADLSSSMESLAYDSSV--ASPGSVSSHTQRTKRMRTSFKHHQLRTMKSYFAINQ 259
Query: 174 NPDAKDLKQLAQKTGLSKRVLQ 195
NPDAKDLKQLAQKTGLSKRVLQ
Sbjct: 260 NPDAKDLKQLAQKTGLSKRVLQ 281
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380690603|gb|AFD93370.1| apterous, partial [Cydia pomonella] | Back alignment and taxonomy information |
|---|
| >gi|328925124|dbj|BAK19077.1| apterous B alpha [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|225543484|ref|NP_001139388.1| apterous [Tribolium castaneum] gi|224459214|gb|ACN43342.1| apterous b [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328787166|ref|XP_003250891.1| PREDICTED: LIM/homeobox protein Lhx9-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383850874|ref|XP_003700999.1| PREDICTED: LIM/homeobox protein Lhx9-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380027052|ref|XP_003697250.1| PREDICTED: LIM/homeobox protein Lhx9-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242023961|ref|XP_002432399.1| LIM/homeobox protein Lhx2, putative [Pediculus humanus corporis] gi|212517822|gb|EEB19661.1| LIM/homeobox protein Lhx2, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|350404759|ref|XP_003487211.1| PREDICTED: LIM/homeobox protein Lhx9-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340721020|ref|XP_003398925.1| PREDICTED: LIM/homeobox protein Lhx9-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 196 | ||||||
| UNIPROTKB|E1BM14 | 406 | LHX2 "Uncharacterized protein" | 0.255 | 0.123 | 0.9 | 3.6e-43 | |
| UNIPROTKB|E2RPC3 | 406 | LHX2 "Uncharacterized protein" | 0.255 | 0.123 | 0.9 | 3.6e-43 | |
| UNIPROTKB|P50458 | 406 | LHX2 "LIM/homeobox protein Lhx | 0.255 | 0.123 | 0.9 | 3.6e-43 | |
| UNIPROTKB|C4TJC6 | 406 | Lhx2 "LIM homeobox protein 2" | 0.255 | 0.123 | 0.9 | 3.6e-43 | |
| MGI|MGI:96785 | 406 | Lhx2 "LIM homeobox protein 2" | 0.255 | 0.123 | 0.9 | 3.6e-43 | |
| UNIPROTKB|D4A380 | 406 | Lhx2 "LIM/homeobox protein Lhx | 0.255 | 0.123 | 0.9 | 3.6e-43 | |
| UNIPROTKB|H7C0H1 | 412 | LHX2 "LIM/homeobox protein Lhx | 0.255 | 0.121 | 0.9 | 4.4e-43 | |
| UNIPROTKB|G3N0G6 | 427 | LHX2 "Uncharacterized protein" | 0.255 | 0.117 | 0.9 | 6.6e-43 | |
| RGD|71076 | 426 | Lhx2 "LIM homeobox 2" [Rattus | 0.255 | 0.117 | 0.9 | 8.1e-43 | |
| UNIPROTKB|P36198 | 426 | Lhx2 "LIM/homeobox protein Lhx | 0.255 | 0.117 | 0.9 | 8.1e-43 |
| UNIPROTKB|E1BM14 LHX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 230 (86.0 bits), Expect = 3.6e-43, Sum P(3) = 3.6e-43
Identities = 45/50 (90%), Positives = 47/50 (94%)
Query: 146 SHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195
S Q+TKRMRTSFKHHQLRTMKSYF IN NPDAKDLKQLAQKTGL+KRVLQ
Sbjct: 262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 311
|
|
| UNIPROTKB|E2RPC3 LHX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P50458 LHX2 "LIM/homeobox protein Lhx2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C4TJC6 Lhx2 "LIM homeobox protein 2" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96785 Lhx2 "LIM homeobox protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A380 Lhx2 "LIM/homeobox protein Lhx2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C0H1 LHX2 "LIM/homeobox protein Lhx2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N0G6 LHX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|71076 Lhx2 "LIM homeobox 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P36198 Lhx2 "LIM/homeobox protein Lhx2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| cd09377 | 59 | cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of | 1e-30 | |
| cd09474 | 59 | cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 | 2e-20 | |
| cd09475 | 59 | cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | 2e-18 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 4e-14 | |
| cd09378 | 55 | cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o | 3e-13 | |
| cd09379 | 55 | cd09379, LIM2_AWH, The second LIM domain of Arrowh | 1e-12 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 1e-12 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 2e-12 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 3e-12 | |
| cd09471 | 55 | cd09471, LIM2_Isl2, The second LIM domain of Isl2 | 3e-12 | |
| cd09375 | 56 | cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of | 2e-11 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-11 | |
| cd09387 | 55 | cd09387, LIM2_LMO4, The second LIM domain of LMO4 | 3e-11 | |
| cd09374 | 55 | cd09374, LIM2_Isl, The second LIM domain of Isl, a | 4e-11 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 7e-11 | |
| cd09472 | 57 | cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 | 2e-09 | |
| cd09376 | 56 | cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of | 2e-09 | |
| cd09382 | 55 | cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 | 3e-09 | |
| cd09389 | 55 | cd09389, LIM2_LMO1_LMO3, The second LIM domain of | 4e-09 | |
| cd09383 | 55 | cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of | 7e-09 | |
| cd09473 | 56 | cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 | 1e-08 | |
| cd09390 | 55 | cd09390, LIM2_dLMO, The second LIM domain of dLMO | 1e-07 | |
| cd09327 | 52 | cd09327, LIM1_abLIM, The first LIM domain of actin | 1e-05 | |
| cd09385 | 56 | cd09385, LIM2_LMO2, The second LIM domain of LMO2 | 3e-05 | |
| cd09350 | 54 | cd09350, LIM1_TRIP6, The first LIM domain of Thyro | 9e-05 | |
| cd09451 | 53 | cd09451, LIM_RIL, The LIM domain of RIL | 9e-05 | |
| cd09365 | 54 | cd09365, LIM2_LIMK, The second LIM domain of LIMK | 2e-04 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 5e-04 | |
| cd09464 | 55 | cd09464, LIM2_LIMK1, The second LIM domain of LIMK | 6e-04 | |
| cd09366 | 55 | cd09366, LIM1_Isl, The first LIM domain of Isl, a | 0.001 | |
| cd09486 | 53 | cd09486, LIM_Eplin_like_1, a LIM domain subfamily | 0.001 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 0.001 | |
| cd09414 | 58 | cd09414, LIM1_LIMPETin, The first LIM domain of pr | 0.001 | |
| cd09392 | 53 | cd09392, LIM2_Lrg1p_like, The second LIM domain of | 0.004 | |
| cd09360 | 52 | cd09360, LIM_ALP_like, The LIM domain of ALP (acti | 0.004 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 0.004 |
| >gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
Score = 106 bits (266), Expect = 1e-30
Identities = 37/50 (74%), Positives = 43/50 (86%)
Query: 1 MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
+GIS+SELVMRARDLVFHL+CFTC +C LTKGD FGMRD ++YCR HY
Sbjct: 10 LGISASELVMRARDLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCRLHY 59
|
The second LIM domain of Lhx2 and Lhx9 family: Lhx2 and Lhx9 are highly homologous LHX regulatory proteins. They belong to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. Although Lhx2 and Lhx9 are highly homologous, they seems to play regulatory roles in different organs. In animals, Lhx2 plays important roles in eye, cerebral cortex, limb, the olfactory organs, and erythrocyte development. Lhx2 gene knockout mice exhibit impaired patterning of the cortical hem and the telencephalon of the developing brain, and a lack of development in olfactory structures. Lhx9 is expressed in several regions of the developing mouse brain, the spinal cord, the pancreas, in limb mesenchyme, and in the urogenital region. Lhx9 plays critical roles in gonad development. Homozygous mice lacking functional Lhx9 alleles exhibit numerous urogenital defects, such as gonadal agenesis, infertility, and undetectable levels of testosterone and estradiol coupled with high FSH levels. Lhx9 null mice are phenotypically female, even those that are genotypically male. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 59 |
| >gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 | Back alignment and domain information |
|---|
| >gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) | Back alignment and domain information |
|---|
| >gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) | Back alignment and domain information |
|---|
| >gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL | Back alignment and domain information |
|---|
| >gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain Kinase 1) | Back alignment and domain information |
|---|
| >gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of proteins with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family | Back alignment and domain information |
|---|
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| KOG4577|consensus | 383 | 99.82 | ||
| KOG0484|consensus | 125 | 99.21 | ||
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.05 | |
| KOG2251|consensus | 228 | 99.0 | ||
| KOG0490|consensus | 235 | 98.96 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 98.94 | |
| KOG0850|consensus | 245 | 98.9 | ||
| KOG0488|consensus | 309 | 98.85 | ||
| KOG0843|consensus | 197 | 98.81 | ||
| KOG0489|consensus | 261 | 98.78 | ||
| KOG0485|consensus | 268 | 98.78 | ||
| KOG0494|consensus | 332 | 98.75 | ||
| KOG0842|consensus | 307 | 98.74 | ||
| KOG1701|consensus | 468 | 98.73 | ||
| KOG0486|consensus | 351 | 98.73 | ||
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 98.72 | |
| KOG1701|consensus | 468 | 98.59 | ||
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 98.57 | |
| KOG0493|consensus | 342 | 98.51 | ||
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 98.42 | |
| KOG0492|consensus | 246 | 98.35 | ||
| KOG0490|consensus | 235 | 98.32 | ||
| KOG0487|consensus | 308 | 98.27 | ||
| KOG2272|consensus | 332 | 98.22 | ||
| KOG0848|consensus | 317 | 98.13 | ||
| KOG0491|consensus | 194 | 98.1 | ||
| KOG4577|consensus | 383 | 98.07 | ||
| KOG0849|consensus | 354 | 97.97 | ||
| KOG0844|consensus | 408 | 97.92 | ||
| KOG2272|consensus | 332 | 97.87 | ||
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 97.64 | |
| KOG1703|consensus | 479 | 97.63 | ||
| KOG3802|consensus | 398 | 97.62 | ||
| KOG1044|consensus | 670 | 97.45 | ||
| KOG2252|consensus | 558 | 97.32 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 97.29 | |
| KOG1044|consensus | 670 | 96.89 | ||
| KOG1702|consensus | 264 | 96.81 | ||
| KOG1168|consensus | 385 | 96.32 | ||
| KOG1700|consensus | 200 | 96.32 | ||
| KOG0483|consensus | 198 | 96.29 | ||
| KOG0847|consensus | 288 | 96.07 | ||
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 95.66 | |
| KOG1700|consensus | 200 | 95.27 | ||
| KOG0775|consensus | 304 | 93.68 | ||
| KOG0774|consensus | 334 | 91.84 | ||
| KOG1146|consensus | 1406 | 89.32 | ||
| KOG1703|consensus | 479 | 87.75 | ||
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 84.38 |
| >KOG4577|consensus | Back alignment and domain information |
|---|
Probab=99.82 E-value=8e-21 Score=157.29 Aligned_cols=112 Identities=36% Similarity=0.670 Sum_probs=95.8
Q ss_pred CCCChHHHHHHHHhHHHhhhhhhhhhhcceeccCCcccc-ccceeeeccchhhhhhccccCcccccCCCCCCCCCCCCcc
Q psy17504 1 MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGM-RDEMIYCRPHYEILRHRDYCGSAEIEQPMSPRPAPWQPTT 79 (196)
Q Consensus 1 ~~i~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~G~~f~~-~~~~~~C~~~y~~~~~~~~~~~~~~~~~~~p~~~~~~~~~ 79 (196)
+||.|+..|.+|.+.+||+.||.|++|+++|.+|++|++ .++++.|+.||+....-..
T Consensus 100 ~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~--------------------- 158 (383)
T KOG4577|consen 100 EGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHC--------------------- 158 (383)
T ss_pred CCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhccc---------------------
Confidence 589999999999999999999999999999999999965 6789999999986532100
Q ss_pred cccCCcccccccccCCCCCccccccceeeccccchhhhccCCccccccccccccCCCCCCCCCccccccccchhhcccch
Q psy17504 80 VQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSSPGSGVHSHQRTKRMRTSFKH 159 (196)
Q Consensus 80 ~~~g~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gs~~~~~~k~rR~RT~ft~ 159 (196)
. .+++ + ...||+||++|+
T Consensus 159 --------------------------------~-----------------~l~g--d-----------~~nKRPRTTItA 176 (383)
T KOG4577|consen 159 --------------------------------N-----------------ELEG--D-----------ASNKRPRTTITA 176 (383)
T ss_pred --------------------------------c-----------------cccc--c-----------cccCCCcceeeH
Confidence 0 0111 0 124789999999
Q ss_pred hhHhhhhhhhcccCCCChHHHHHHHHHhCcchhhhc
Q psy17504 160 HQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195 (196)
Q Consensus 160 ~Ql~~L~~~F~~~~~p~~~~r~~La~~lgL~~~~Vq 195 (196)
.||+.|+.+|...+.|.++.||+|+..+||..++||
T Consensus 177 KqLETLK~AYn~SpKPARHVREQLsseTGLDMRVVQ 212 (383)
T KOG4577|consen 177 KQLETLKQAYNTSPKPARHVREQLSSETGLDMRVVQ 212 (383)
T ss_pred HHHHHHHHHhcCCCchhHHHHHHhhhccCcceeehh
Confidence 999999999999999999999999999999999997
|
|
| >KOG0484|consensus | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >KOG0485|consensus | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG2252|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 196 | ||||
| 2dmq_A | 80 | Solution Structure Of The Homeobox Domain Of LimHOM | 1e-18 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 2e-07 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 4e-07 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 1e-06 | ||
| 2da1_A | 70 | Solution Structure Of The First Homeobox Domain Of | 6e-05 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 2e-04 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 2e-04 |
| >pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 | Back alignment and structure |
|
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|2DA1|A Chain A, Solution Structure Of The First Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 196 | |||
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 2e-21 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 5e-21 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 1e-19 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 3e-19 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 6e-09 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 4e-19 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 6e-07 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 5e-19 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 1e-06 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 9e-19 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 3e-17 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-17 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-16 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 5e-07 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 2e-16 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 2e-15 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 1e-14 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 3e-12 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 4e-12 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 3e-08 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 4e-12 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 6e-12 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 1e-11 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 1e-11 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 2e-11 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 2e-11 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 4e-11 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 9e-11 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 2e-10 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 7e-10 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 1e-09 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-09 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 5e-08 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 2e-09 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-09 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 3e-09 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 5e-09 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 8e-09 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 9e-09 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 1e-08 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 1e-08 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 1e-08 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 1e-08 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 3e-08 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 3e-08 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 4e-08 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 5e-08 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 5e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 8e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 8e-05 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 1e-07 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 1e-07 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 2e-07 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 3e-07 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 3e-07 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 3e-07 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 4e-07 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 5e-07 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 5e-07 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 5e-07 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 5e-07 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 6e-07 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 7e-07 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 2e-06 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-06 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 3e-05 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 2e-06 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 3e-06 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 1e-05 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 7e-05 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 1e-04 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 1e-04 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 2e-04 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 2e-04 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 3e-04 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 3e-04 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 3e-04 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 4e-04 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 6e-04 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 7e-04 |
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.38 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.29 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.25 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.25 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.23 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.23 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.16 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.15 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.15 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.13 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.13 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.12 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.1 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.09 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.09 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.09 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.08 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.08 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.08 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.07 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.07 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.06 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.06 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.05 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.04 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.04 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.03 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.03 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.02 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.02 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.02 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.02 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.01 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.01 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.0 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 98.99 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 98.99 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 98.99 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 98.98 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 98.97 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 98.97 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 98.97 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 98.97 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 98.96 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 98.96 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 98.95 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 98.95 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 98.95 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 98.95 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 98.94 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 98.93 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 98.93 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 98.92 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 98.91 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 98.9 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 98.9 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 98.9 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 98.9 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 98.88 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 98.88 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 98.88 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 98.87 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 98.87 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 98.86 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 98.85 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 98.85 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 98.85 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 98.84 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 98.84 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 98.84 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 98.84 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 98.84 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 98.83 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 98.83 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 98.82 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 98.81 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 98.8 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 98.8 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 98.79 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 98.79 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 98.78 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 98.78 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 98.77 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 98.76 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 98.76 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 98.75 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 98.75 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 98.75 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 98.75 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 98.74 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 98.74 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 98.74 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 98.74 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 98.73 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 98.73 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 98.73 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 98.72 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 98.67 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 98.67 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 98.66 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 98.65 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 98.63 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 98.6 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 98.57 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 98.56 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 98.56 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 98.54 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 98.54 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 98.53 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 98.52 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 98.46 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 98.45 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 98.44 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 98.44 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 98.43 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 98.4 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 98.29 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 98.25 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 98.25 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 98.24 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 98.16 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 98.14 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 97.84 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 97.53 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 93.11 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 92.67 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 81.44 |
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
Probab=99.38 E-value=6.8e-15 Score=114.64 Aligned_cols=53 Identities=43% Similarity=0.943 Sum_probs=46.0
Q ss_pred CCChHHHHHHHHhHHHhhhhhhhhhhcceeccCCccc-cccceeeeccchhhhh
Q psy17504 2 GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFG-MRDEMIYCRPHYEILR 54 (196)
Q Consensus 2 ~i~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~G~~f~-~~~~~~~C~~~y~~~~ 54 (196)
.|.+.++|++|.+..||..||+|..|+++|..|+.|+ +.++++||+.||..++
T Consensus 74 ~I~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~g~~~C~~c~~~~~ 127 (169)
T 2rgt_A 74 GIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK 127 (169)
T ss_dssp BCCTTSEEEEETTEEEEGGGCBCTTTCCBCCTTCEEEECTTSCEEEHHHHHHHH
T ss_pred ccCCCcEEEEcCCceEeeCCCcCCCCCCCCCCCCceEEccCCeEECHHHHHHHh
Confidence 4666677888999999999999999999997788875 4689999999998765
|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 196 | ||||
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 5e-10 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 1e-09 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 1e-09 | |
| d1rutx3 | 31 | g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus | 1e-08 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 3e-08 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 4e-08 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 5e-08 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 8e-08 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 2e-07 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 3e-07 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 4e-07 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 5e-07 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 5e-07 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 5e-07 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 8e-07 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 9e-07 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 1e-06 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 2e-06 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 3e-06 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 4e-06 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 6e-06 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 6e-06 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 7e-06 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 8e-06 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 9e-06 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 2e-05 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 3e-05 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 1e-04 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 4e-04 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 7e-04 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 0.002 | |
| d1g47a2 | 35 | g.39.1.3 (A:36-70) Pinch (particularly interesting | 0.004 |
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-a9 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 51.8 bits (124), Expect = 5e-10
Identities = 10/59 (16%), Positives = 26/59 (44%)
Query: 138 SSPGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN 196
++P + + T++ R + HQ ++ F N ++A+ L++R ++
Sbjct: 1 NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKI 59
|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 196 | |||
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.22 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.21 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.2 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.19 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.19 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.18 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.18 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.16 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.15 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.15 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.14 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.11 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.11 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.1 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.08 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.08 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.05 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.05 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.02 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 98.95 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 98.92 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 98.9 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 98.85 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 98.79 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 98.52 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 98.51 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 98.51 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 98.44 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.3 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.29 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 98.27 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 98.24 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 98.19 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.95 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.77 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.76 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.71 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.69 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.67 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.56 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.25 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.13 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.09 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.87 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.73 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 96.59 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.56 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.54 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 96.5 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.48 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 95.98 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.83 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 94.64 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 94.24 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 93.75 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 92.63 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 90.73 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 90.36 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 89.78 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 89.06 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 88.32 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 87.96 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 87.35 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 86.94 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 85.36 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 80.3 |
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: VND/NK-2 protein species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.22 E-value=3e-12 Score=85.82 Aligned_cols=49 Identities=16% Similarity=0.244 Sum_probs=46.0
Q ss_pred ccccchhhcccchhhHhhhhhhhcccCCCChHHHHHHHHHhCcchhhhc
Q psy17504 147 HQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195 (196)
Q Consensus 147 ~~k~rR~RT~ft~~Ql~~L~~~F~~~~~p~~~~r~~La~~lgL~~~~Vq 195 (196)
..+.||.||.||.+|+.+|+..|+.++||+...+++||..+||++.+|+
T Consensus 6 p~k~rr~Rt~ft~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qV~ 54 (77)
T d1vnda_ 6 PNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVK 54 (77)
T ss_dssp SSSSCSSCCCCCTTHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHH
T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhhhh
Confidence 3466778999999999999999999999999999999999999999997
|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|