Diaphorina citri psyllid: psy17509


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MAIIRGIFLFYVIFYSILACLFAICMYVLMSTLTDEYPKLQLDESIIGVNPGLGFRPMSSDPEAASLIRYKINNTESASMWTKEIDNYLEGNLLFPDLEVYKNPQKLPGNQVKCDYDNPPPQGKICEIELEKNMGPCTEAFNYGFTAGKPCVFIKLNKENGYSHDYRLVKK
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEEcccccccccccccccc
**IIRGIFLFYVIFYSILACLFAICMYVLMSTLTDEYPKLQLDESIIGVNPGLGFRPMSSDPEAASLIRYKINNTESASMWTKEIDNYLEGNLLFPDLEVYKNPQKLPGNQVKCDY*NPPPQGKICEIELEKNMGPCTEAFNYGFTAGKPCVFIKLNKENGYSHDYR****
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIIRGIFLFYVIFYSILACLFAICMYVLMSTLTDEYPKLQLDESIIGVNPGLGFRPMSSDPEAASLIRYKINNTESASMWTKEIDNYLEGNLLFPDLEVYKNPQKLPGNQVKCDYDNPPPQGKICEIELEKNMGPCTEAFNYGFTAGKPCVFIKLNKENGYSHDYRLVKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008324 [MF]cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0005575 [CC]cellular_componentprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZXE, chain B
Confidence level:very confident
Coverage over the Query: 2-169
View the alignment between query and template
View the model in PyMOL