Diaphorina citri psyllid: psy17511

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------

MGLKKEKCFIEQPSLTVGVTRRTFTNQKRFQPPSIMANGAHVKVKEYVDNVKSQAEELILKGFPEKIVILNDLLATEQFQVEDVTKIHQDINIPVPEPITLNSHSDGPVTKKAKRELDNDVSGTPVLLLTNGPVPSNEKLKLMISVVKPHIKQLVEHSNVLKMWITFMIPKIEDGNNFGVSIQEDILAEIQSVESEAAAFYDQMSRYFVSRAKVISKVAKYPHIADYRQAVKELDEKEYLSLWLVKEYVDTVKSQAEELILKGFPEKIVILNDLLATEQFQVEDVTKIHQDINIPIPEPITLNSHSDGPVTKKAKRELDNDVSGTPVLLLTNGPVPSNEKLKLMISVVKPHIKQLVEHSNVLKMWITFMIPKIEDGNNFGVSIQEDILAEIQSVESEAAAFYDQMSRYFVSRAKVISKVAKYPHIADYRQAVKELDEKEYLSLWLVLCEIRNRYLCLKTIVHFMTL

cccccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

******KCFIEQPSLTVGVTRRTFTNQ**F***SIMANGAHVKVKEYVDNVKSQAEELILKGFPEKIVILNDLLATEQFQVEDVTKIHQDINIPVP*****************************VLLLTNGPVPSNEKLKLMISVVKPHIKQLVEHSNVLKMWITFMIPKIEDGNNFGVSIQEDILAEIQSVESEAAAFYDQMSRYFVSRAKVISKVAKYPHIADYRQAVKELDEKEYLSLWLVKEYVDTVKSQAEELILKGFPEKIVILNDLLATEQFQVEDVTKIHQDINIPIPEP***************************VLLLTNGPVPSNEKLKLMISVVKPHIKQLVEHSNVLKMWITFMIPKIEDGNNFGVSIQEDILAEIQSVESEAAAFYDQMSRYFVSRAKVISKVAKYPHIADYRQAVKELDEKEYLSLWLVLCEIRNRYLCLKTIVHFMTL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005705 [CC]	polytene chromosome interband	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005703 [CC]	polytene chromosome puff	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0004866 [MF]	endopeptidase inhibitor activity	probable	GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0061136 [BP]	regulation of proteasomal protein catabolic process	probable	GO:0009894, GO:0032268, GO:0080090, GO:0031329, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0008150, GO:0042176, GO:0030162, GO:0065007, GO:0019222, GO:0050789
GO:0061133 [MF]	endopeptidase activator activity	probable	GO:0061135, GO:0061134, GO:0003674, GO:0008047, GO:0016504, GO:0030234
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AVO, chain B
Confidence level:very confident
Coverage over the Query: 334-464
View the alignment between query and template
View the model in PyMOL

Template: 1AVO, chain B
Confidence level:very confident
Coverage over the Query: 133-264
View the alignment between query and template
View the model in PyMOL

Template: 1AVO, chain A
Confidence level:very confident
Coverage over the Query: 36-93
View the alignment between query and template
View the model in PyMOL

Template: 1AVO, chain A
Confidence level:very confident
Coverage over the Query: 243-294
View the alignment between query and template
View the model in PyMOL