Diaphorina citri psyllid: psy17516


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MNPHEVTRKYQKLKEQRDKLERTVDKKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccEEEEccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHcccccccEEcccccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcEEECccccEEEEEEEEcc
***H*********************KKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPHEVTRKxxxxxxxxxxxxxxxxxxxxxxxxNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDxxxxxxxxxxxxxxxxxxxxxAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 2 Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.confidentQ54PK4
Structural maintenance of chromosomes protein 2-2 Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Also involved in chromosome segregation in meiosis.confidentQ9SN90
Structural maintenance of chromosomes protein 2 Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.confidentQ8CG48

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000796 [CC]condensin complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0007076 [BP]mitotic chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0016043, GO:0007067, GO:0044699, GO:0006139, GO:0044260, GO:1901360, GO:0000280, GO:0006323, GO:0071704, GO:0071840, GO:0000278, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0007059, GO:0046483, GO:0006996, GO:0030261, GO:0007049, GO:0000070, GO:0000819, GO:0051276, GO:0044237, GO:0043170, GO:0048285, GO:0006259, GO:0044763
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003680 [MF]AT DNA bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000228 [CC]nuclear chromosomeprobableGO:0005575, GO:0031981, GO:0043232, GO:0043233, GO:0043227, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0005694, GO:0043226, GO:0044422, GO:0043231
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0000217 [MF]DNA secondary structure bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KTA, chain B
Confidence level:very confident
Coverage over the Query: 112-260
View the alignment between query and template
View the model in PyMOL
Template: 3TUI, chain C
Confidence level:very confident
Coverage over the Query: 28-46,60-254
View the alignment between query and template
View the model in PyMOL