Psyllid ID: psy17516

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----

MNPHEVTRKYQKLKEQRDKLERTVDKKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccEEEEccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHcccccccEEcccccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcEEEEccccEEEEEEEEcc

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccEEEEEccccccccHEHHcccHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHEEEEEEcccccEEEEEEEEcc

MNPHEVTRKYQKLKEQRDKLERTVDKKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSlllpgsqaklsppagkdildgLEVNVAFGGLWkeslgelsggQRSLVALSLVLAMLlfkpaplyilDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKegmfsnanVIFRTkfvdgnsnvtrtvnrkn

mnphevtrkyqklkeqrdklertvdkkaqlslrneenqfkvgamvKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMtkksivesdrAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFrtkfvdgnsnvtrtvnrkn

MNPHEVTRKYQKLKEQRDKLERTVDKKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRslvalslvlamllFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN

**************************************FKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKL***AGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDG************

***H*********************KKAQLSLRNEENQFKVGA******************************MVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNR**

*************KEQRDKLERTVDKKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNPHEVTRKxxxxxxxxxxxxxxxxxxxxxxxxNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDxxxxxxxxxxxxxxxxxxxxxAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		264	2.2.26 [Sep-21-2011]
P50533		1203	Structural maintenance of	N/A	N/A	0.662	0.145	0.708	2e-70
O95347		1197	Structural maintenance of	yes	N/A	0.662	0.146	0.708	1e-69
Q8CG48		1191	Structural maintenance of	yes	N/A	0.640	0.141	0.727	2e-69
Q9SN90		1171	Structural maintenance of	yes	N/A	0.662	0.149	0.731	2e-66
Q9C5Y4		1175	Structural maintenance of	no	N/A	0.659	0.148	0.718	1e-64
Q54PK4		1184	Structural maintenance of	yes	N/A	0.659	0.146	0.701	4e-63
Q90988		1189	Structural maintenance of	yes	N/A	0.647	0.143	0.695	7e-60
P38989		1170	Structural maintenance of	yes	N/A	0.613	0.138	0.629	6e-56
Q09591		1244	Mitotic chromosome and X-	yes	N/A	0.636	0.135	0.636	7e-56
P41003		1172	Structural maintenance of	yes	N/A	0.609	0.137	0.577	7e-54

>sp\|P50533\|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1	Back alignment and function desciption

 Score =  266 bits (679), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/175 (70%), Positives = 145/175 (82%)

Query: 90   MTKKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAG 149
            M +K IVE+D++K+L  IEELD+KK  AL  AW KVN DFGSIFS LLPG+ A L+PP G
Sbjct: 1003 MKRKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEG 1062

Query: 150  KDILDGLEVNVAFGGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDL 209
            + +LDGLE  VA G  WKE+L ELSGGQRSLVALSL+LAMLLFKPAP+YILDEVDAALDL
Sbjct: 1063 QSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDL 1122

Query: 210  SHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRTVNRKN 264
            SHTQNIGQML+ HF+ SQFI+VSLK+GMF+NANV+F+TKFVDG S V R    +N
Sbjct: 1123 SHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVARFAQNQN 1177

Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
Xenopus laevis (taxid: 8355)

>sp\|O95347\|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2	Back alignment and function description

>sp\|Q8CG48\|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2	Back alignment and function description

>sp\|Q9SN90\|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1	Back alignment and function description

>sp\|Q9C5Y4\|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2	Back alignment and function description

>sp\|Q54PK4\|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1	Back alignment and function description

>sp\|Q90988\|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1	Back alignment and function description

>sp\|P38989\|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1	Back alignment and function description

>sp\|Q09591\|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2	Back alignment and function description

>sp\|P41003\|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		264
157136238		1182	structural maintenance of chromosomes sm	0.806	0.180	0.534	5e-72
74095929		1200	SMC2 protein [Takifugu rubripes] gi\|2780	0.803	0.176	0.540	5e-71
170048005		1178	structural maintenance of chromosomes sm	0.806	0.180	0.534	5e-71
348529374		1197	PREDICTED: structural maintenance of chr	0.803	0.177	0.544	7e-71
127139521		1199	structural maintenance of chromosomes 2	0.803	0.176	0.544	9e-71
260811386		1229	hypothetical protein BRAFLDRAFT_129060 [	0.795	0.170	0.540	2e-70
432844433		1201	PREDICTED: structural maintenance of chr	0.803	0.176	0.544	4e-70
449685260		626	PREDICTED: structural maintenance of chr	0.647	0.273	0.736	7e-70
307207691		1177	Structural maintenance of chromosomes pr	0.651	0.146	0.726	7e-70
242007208		1186	structural maintenance of chromosome, pu	0.765	0.170	0.655	8e-70

>gi\|157136238\|ref\|XP_001656789.1\| structural maintenance of chromosomes smc2 [Aedes aegypti] gi\|108881057\|gb\|EAT45282.1\| AAEL003449-PA [Aedes aegypti]	Back alignment and taxonomy information

 Score =  276 bits (707), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 171/260 (65%), Gaps = 47/260 (18%)

Query: 2    NPHEVTRKYQKLKEQRDKLERTVDKKAQLSLRNEENQFKVGAMVKAPLKTLLFISMKKYL 61
            +P E  RK  KL++ ++K+ R +++KA + L  EE Q+K                     
Sbjct: 959  DPQEAGRKLNKLQDSKEKMSRNINQKAMVLLEREEEQYK--------------------- 997

Query: 62   GSMSSFSVKVGAMVKAPLRTLLFISMEAMTKKSIVESDRAKLLKVIEELDEKKKIALREA 121
                                      E M +K +VE D+ K+ K+I +LDE+KK  L+ A
Sbjct: 998  --------------------------EVMRRKQVVEDDKKKIQKIITDLDEEKKKQLKVA 1031

Query: 122  WLKVNTDFGSIFSLLLPGSQAKLSPPAGKDILDGLEVNVAFGGLWKESLGELSGGQRSLV 181
            W +VN +FGSIFS LLPG+QA+L PP G D + GLEV V F G+WKESL ELSGGQRSLV
Sbjct: 1032 WTEVNENFGSIFSTLLPGTQAQLKPPDGVDFMKGLEVKVGFNGMWKESLTELSGGQRSLV 1091

Query: 182  ALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFKTSQFIIVSLKEGMFSNA 241
            ALSL+LAML +KPAPLYILDEVDAALDLSHTQNIG MLK HF  SQF+IVSLK+GMF+NA
Sbjct: 1092 ALSLILAMLKYKPAPLYILDEVDAALDLSHTQNIGNMLKAHFTNSQFVIVSLKDGMFNNA 1151

Query: 242  NVIFRTKFVDGNSNVTRTVN 261
            NV+FRTKF+DG S VTRTVN
Sbjct: 1152 NVLFRTKFIDGMSGVTRTVN 1171

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|74095929\|ref\|NP_001027796.1\| SMC2 protein [Takifugu rubripes] gi\|27805179\|emb\|CAD58848.2\| SMC2 protein [Takifugu rubripes]	Back alignment and taxonomy information

>gi\|170048005\|ref\|XP_001851491.1\| structural maintenance of chromosomes smc2 [Culex quinquefasciatus] gi\|167870242\|gb\|EDS33625.1\| structural maintenance of chromosomes smc2 [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|348529374\|ref\|XP_003452188.1\| PREDICTED: structural maintenance of chromosomes protein 2-like [Oreochromis niloticus]	Back alignment and taxonomy information

>gi\|127139521\|ref\|NP_955836.2\| structural maintenance of chromosomes 2 [Danio rerio]	Back alignment and taxonomy information

>gi\|260811386\|ref\|XP_002600403.1\| hypothetical protein BRAFLDRAFT_129060 [Branchiostoma floridae] gi\|229285690\|gb\|EEN56415.1\| hypothetical protein BRAFLDRAFT_129060 [Branchiostoma floridae]	Back alignment and taxonomy information

>gi\|432844433\|ref\|XP_004065767.1\| PREDICTED: structural maintenance of chromosomes protein 2-like [Oryzias latipes]	Back alignment and taxonomy information

>gi\|449685260\|ref\|XP_002154830.2\| PREDICTED: structural maintenance of chromosomes protein 2-like, partial [Hydra magnipapillata]	Back alignment and taxonomy information

>gi\|307207691\|gb\|EFN85328.1\| Structural maintenance of chromosomes protein 2 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|242007208\|ref\|XP_002424434.1\| structural maintenance of chromosome, putative [Pediculus humanus corporis] gi\|212507834\|gb\|EEB11696.1\| structural maintenance of chromosome, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		264
ZFIN\|ZDB-GENE-030131-105		1232	smc2 "structural maintenance o	0.636	0.136	0.672	4e-60
DICTYBASE\|DDB_G0284499		1184	smc2 "structural maintenance o	0.670	0.149	0.646	8.1e-60
TAIR\|locus:2167973		1175	SMC2 "AT5G62410" [Arabidopsis	0.659	0.148	0.660	1.2e-59
UNIPROTKB\|F1SP73		1169	F1SP73 "Uncharacterized protei	0.670	0.151	0.638	4.5e-59
UNIPROTKB\|F1SRP0		1191	SMC2 "Structural maintenance o	0.670	0.148	0.638	5e-59
TAIR\|locus:2079107		1171	ATSMC2 "AT3G47460" [Arabidopsi	0.973	0.219	0.511	6.4e-59
UNIPROTKB\|D4A5Q2		1191	Smc2 "Structural maintenance o	0.670	0.148	0.638	1e-58
UNIPROTKB\|E2R7R8		1191	SMC2 "Structural maintenance o	0.670	0.148	0.638	1e-58
UNIPROTKB\|O95347		1197	SMC2 "Structural maintenance o	0.670	0.147	0.638	1.1e-58
RGD\|1305227		1230	Smc2 "structural maintenance o	0.670	0.143	0.638	1.2e-58

ZFIN\|ZDB-GENE-030131-105 smc2 "structural maintenance of chromosomes 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 579 (208.9 bits), Expect = 4.0e-60, Sum P(2) = 4.0e-60
 Identities = 113/168 (67%), Positives = 131/168 (77%)

Query:    92 KKSIVESDRAKLLKVIEELDEKKKIALREAWLKVNTDFGSIFSLLLPGSQAKLSPPAGKD 151
             KK IVE+D+AK+L+ IEELD+KK  AL  AW KVN DFGSIFS LLPG+ A+L+PP G  
Sbjct:  1006 KKRIVENDKAKILETIEELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEGCG 1065

Query:   152 ILDGLEVNVAFGGLWKESLGELSGGQRXXXXXXXXXXXXXFKPAPLYILDEVDAALDLSH 211
             +LDGLE  VA G  WKE+L ELSGGQR             FKPAP+YILDEVDAALDLSH
Sbjct:  1066 VLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSH 1125

Query:   212 TQNIGQMLKRHFKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVTRT 259
             TQNIGQML+ HF  SQF++VSLK+GMF+NANV+F+TKFVDG S VTRT
Sbjct:  1126 TQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGISTVTRT 1173

GO:0030261 "chromosome condensation" evidence=IEA

GO:0005694 "chromosome" evidence=IEA

GO:0007062 "sister chromatid cohesion" evidence=IEA

GO:0051276 "chromosome organization" evidence=IEA

GO:0006281 "DNA repair" evidence=IEA

GO:0007076 "mitotic chromosome condensation" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006310 "DNA recombination" evidence=IEA

GO:0000796 "condensin complex" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

DICTYBASE\|DDB_G0284499 smc2 "structural maintenance of chromosome protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

TAIR\|locus:2167973 SMC2 "AT5G62410" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SP73 F1SP73 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SRP0 SMC2 "Structural maintenance of chromosomes protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

TAIR\|locus:2079107 ATSMC2 "AT3G47460" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|D4A5Q2 Smc2 "Structural maintenance of chromosomes protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R7R8 SMC2 "Structural maintenance of chromosomes protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|O95347 SMC2 "Structural maintenance of chromosomes protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|1305227 Smc2 "structural maintenance of chromosomes 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O95347	SMC2_HUMAN	No assigned EC number	0.7085	0.6628	0.1461	yes	N/A
P38989	SMC2_YEAST	No assigned EC number	0.6296	0.6136	0.1384	yes	N/A
Q09591	MIX1_CAEEL	No assigned EC number	0.6369	0.6363	0.1350	yes	N/A
Q8CG48	SMC2_MOUSE	No assigned EC number	0.7278	0.6401	0.1418	yes	N/A
P41003	SMC2_SCHPO	No assigned EC number	0.5776	0.6098	0.1373	yes	N/A
Q90988	SMC2_CHICK	No assigned EC number	0.6959	0.6477	0.1438	yes	N/A
Q8IED2	SMC2_PLAF7	No assigned EC number	0.5739	0.6363	0.1379	yes	N/A
Q9SN90	SMC22_ARATH	No assigned EC number	0.7314	0.6628	0.1494	yes	N/A
Q54PK4	SMC2_DICDI	No assigned EC number	0.7011	0.6590	0.1469	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		264
cd03273		251	cd03273, ABC_SMC2_euk, ATP-binding cassette domain	3e-65
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-46
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	7e-40
cd03239		178	cd03239, ABC_SMC_head, The SMC head domain belongs	1e-31
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-28
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	6e-26
cd03278		197	cd03278, ABC_SMC_barmotin, ATP-binding cassette do	5e-24
cd03227		162	cd03227, ABC_Class2, ATP-binding cassette domain o	1e-21
cd03272		243	cd03272, ABC_SMC3_euk, ATP-binding cassette domain	2e-19
cd03274		212	cd03274, ABC_SMC4_euk, ATP-binding cassette domain	6e-19
cd03275		247	cd03275, ABC_SMC1_euk, ATP-binding cassette domain	9e-17
cd00267		157	cd00267, ABC_ATPase, ATP-binding cassette transpor	2e-12
cd03225		211	cd03225, ABC_cobalt_CbiO_domain1, First domain of	7e-07
cd03214		180	cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind	3e-06
COG4988		559	COG4988, CydD, ABC-type transport system involved	1e-05
COG1122		235	COG1122, CbiO, ABC-type cobalt transport system, A	1e-05
cd03228		171	cd03228, ABCC_MRP_Like, ATP-binding cassette domai	3e-05
pfam00005		119	pfam00005, ABC_tran, ABC transporter	4e-05
cd03235		213	cd03235, ABC_Metallic_Cations, ATP-binding cassett	9e-05
COG4133		209	COG4133, CcmA, ABC-type transport system involved	1e-04
COG1132		567	COG1132, MdlB, ABC-type multidrug transport system	1e-04
COG1120		258	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore	2e-04
cd03221		144	cd03221, ABCF_EF-3, ATP-binding cassette domain of	3e-04
PRK13543		214	PRK13543, PRK13543, cytochrome c biogenesis protei	4e-04
COG1121		254	COG1121, ZnuC, ABC-type Mn/Zn transport systems, A	5e-04
cd03240		204	cd03240, ABC_Rad50, ATP-binding cassette domain of	6e-04
COG2274		709	COG2274, SunT, ABC-type bacteriocin/lantibiotic ex	7e-04
TIGR01189		198	TIGR01189, ccmA, heme ABC exporter, ATP-binding pr	7e-04
TIGR02203		571	TIGR02203, MsbA_lipidA, lipid A export permease/AT	8e-04
PRK01156		895	PRK01156, PRK01156, chromosome segregation protein	9e-04
COG4559		259	COG4559, COG4559, ABC-type hemin transport system,	0.001
COG4619		223	COG4619, COG4619, ABC-type uncharacterized transpo	0.001
PRK11231		255	PRK11231, fecE, iron-dicitrate transporter ATP-bin	0.001
PRK13548		258	PRK13548, hmuV, hemin importer ATP-binding subunit	0.001
TIGR03375		694	TIGR03375, type_I_sec_LssB, type I secretion syste	0.001
PRK13539		207	PRK13539, PRK13539, cytochrome c biogenesis protei	0.001
COG1124		252	COG1124, DppF, ABC-type dipeptide/oligopeptide/nic	0.002
COG0488		530	COG0488, Uup, ATPase components of ABC transporter	0.002
cd03237		246	cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin	0.002
COG3840		231	COG3840, ThiQ, ABC-type thiamine transport system,	0.002
cd03231		201	cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog	0.002
COG1245		591	COG1245, COG1245, Predicted ATPase, RNase L inhibi	0.002
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.002
TIGR02857		529	TIGR02857, CydD, thiol reductant ABC exporter, Cyd	0.003
cd03244		221	cd03244, ABCC_MRP_domain2, ATP-binding cassette do	0.004
cd03245		220	cd03245, ABCC_bacteriocin_exporters, ATP-binding c	0.004
cd03298		211	cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin	0.004
cd03248		226	cd03248, ABCC_TAP, ATP-binding cassette domain of	0.004

>gnl\|CDD\|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins	Back alignment and domain information

 Score =  203 bits (519), Expect = 3e-65
 Identities = 80/95 (84%), Positives = 90/95 (94%)

Query: 163 GGLWKESLGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRH 222
           GG+WKESL ELSGGQRSLVALSL+LA+LLFKPAP+YILDEVDAALDLSHTQNIG+M+K H
Sbjct: 157 GGVWKESLTELSGGQRSLVALSLILALLLFKPAPMYILDEVDAALDLSHTQNIGRMIKTH 216

Query: 223 FKTSQFIIVSLKEGMFSNANVIFRTKFVDGNSNVT 257
           FK SQFI+VSLKEGMF+NANV+FRT+FVDG S VT
Sbjct: 217 FKGSQFIVVSLKEGMFNNANVLFRTRFVDGTSTVT 251

The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18). Length = 251

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family	Back alignment and domain information

>gnl\|CDD\|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins	Back alignment and domain information

>gnl\|CDD\|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins	Back alignment and domain information

>gnl\|CDD\|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins	Back alignment and domain information

>gnl\|CDD\|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins	Back alignment and domain information

>gnl\|CDD\|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain	Back alignment and domain information

>gnl\|CDD\|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system	Back alignment and domain information

>gnl\|CDD\|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins	Back alignment and domain information

>gnl\|CDD\|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters	Back alignment and domain information

>gnl\|CDD\|215650 pfam00005, ABC_tran, ABC transporter	Back alignment and domain information

>gnl\|CDD\|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters	Back alignment and domain information

>gnl\|CDD\|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F	Back alignment and domain information

>gnl\|CDD\|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>gnl\|CDD\|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50	Back alignment and domain information

>gnl\|CDD\|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>gnl\|CDD\|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>gnl\|CDD\|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family	Back alignment and domain information

>gnl\|CDD\|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>gnl\|CDD\|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor	Back alignment and domain information

>gnl\|CDD\|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein	Back alignment and domain information

>gnl\|CDD\|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>gnl\|CDD\|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein	Back alignment and domain information

>gnl\|CDD\|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C	Back alignment and domain information

>gnl\|CDD\|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system	Back alignment and domain information

>gnl\|CDD\|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		264
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	100.0
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	100.0
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	100.0
KOG0933\|consensus		1174		100.0
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	100.0
COG2884		223	FtsE Predicted ATPase involved in cell division [C	100.0
COG3638		258	ABC-type phosphate/phosphonate transport system, A	100.0
COG4181		228	Predicted ABC-type transport system involved in ly	100.0
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	100.0
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	100.0
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	100.0
COG1127		263	Ttg2A ABC-type transport system involved in resist	100.0
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	100.0
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	99.98
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	99.97
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	99.97
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	99.97
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	99.97
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	99.97
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	99.97
COG4598		256	HisP ABC-type histidine transport system, ATPase c	99.97
KOG0964\|consensus		1200		99.97
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	99.97
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	99.97
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	99.97
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	99.97
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	99.96
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	99.96
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	99.96
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	99.96
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	99.96
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	99.96
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	99.96
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	99.96
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	99.96
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	99.96
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	99.96
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	99.96
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	99.96
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	99.96
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	99.96
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	99.96
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	99.96
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	99.96
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	99.96
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	99.96
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	99.96
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	99.96
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	99.96
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	99.96
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	99.96
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	99.96
PRK10908		222	cell division protein FtsE; Provisional	99.96
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.96
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.96
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	99.96
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	99.96
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	99.96
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	99.96
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	99.96
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	99.96
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.96
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	99.96
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	99.96
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	99.96
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	99.96
COG1123		539	ATPase components of various ABC-type transport sy	99.96
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	99.96
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	99.96
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	99.96
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	99.96
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.96
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.96
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	99.96
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	99.96
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	99.96
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	99.95
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	99.95
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	99.95
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	99.95
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	99.95
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	99.95
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	99.95
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	99.95
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	99.95
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	99.95
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	99.95
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	99.95
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	99.95
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	99.95
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	99.95
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	99.95
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	99.95
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	99.95
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	99.95
cd03269		210	ABC_putative_ATPase This subfamily is involved in	99.95
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	99.95
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	99.95
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	99.95
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK13536		340	nodulation factor exporter subunit NodI; Provision	99.95
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	99.95
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	99.95
COG1123		539	ATPase components of various ABC-type transport sy	99.95
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	99.95
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	99.95
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	99.95
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	99.95
COG4988		559	CydD ABC-type transport system involved in cytochr	99.95
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	99.95
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	99.95
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	99.95
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	99.95
PRK09984		262	phosphonate/organophosphate ester transporter subu	99.95
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	99.95
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	99.95
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	99.95
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	99.95
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.95
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	99.95
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	99.95
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	99.95
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.95
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	99.95
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.95
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	99.95
PRK10938		490	putative molybdenum transport ATP-binding protein	99.95
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	99.95
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	99.95
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	99.95
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	99.95
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	99.95
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	99.95
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	99.95
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.95
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	99.95
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	99.95
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
COG4987		573	CydC ABC-type transport system involved in cytochr	99.95
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.95
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	99.95
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.95
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	99.95
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	99.95
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	99.95
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.95
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	99.95
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	99.95
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	99.95
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.95
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	99.95
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	99.95
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.95
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.94
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	99.94
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	99.94
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	99.94
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	99.94
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	99.94
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	99.94
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	99.94
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	99.94
PRK03695		248	vitamin B12-transporter ATPase; Provisional	99.94
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	99.94
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	99.94
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	99.94
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	99.94
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	99.94
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	99.94
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	99.94
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	99.94
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	99.94
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	99.94
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.94
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.94
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	99.94
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	99.94
COG4161		242	ArtP ABC-type arginine transport system, ATPase co	99.94
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	99.94
COG4619		223	ABC-type uncharacterized transport system, ATPase	99.94
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	99.94
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	99.94
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	99.94
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	99.94
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	99.94
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	99.94
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	99.94
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	99.94
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	99.94
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	99.94
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.94
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	99.94
COG0411		250	LivG ABC-type branched-chain amino acid transport	99.94
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	99.94
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	99.94
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	99.94
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	99.94
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.94
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	99.94
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	99.94
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.94
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	99.94
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	99.94
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	99.94
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	99.94
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	99.94
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	99.94
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	99.94
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.94
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	99.94
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	99.94
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	99.94
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.94
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	99.94
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	99.94
cd03246		173	ABCC_Protease_Secretion This family represents the	99.94
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.94
COG1137		243	YhbG ABC-type (unclassified) transport system, ATP	99.94
PRK10938		490	putative molybdenum transport ATP-binding protein	99.94
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	99.94
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	99.94
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	99.93
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	99.93
COG4559		259	ABC-type hemin transport system, ATPase component	99.93
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	99.93
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	99.93
cd03234		226	ABCG_White The White subfamily represents ABC tran	99.93
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	99.93
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	99.93
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	99.93
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	99.93
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.93
KOG0057\|consensus		591		99.93
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.93
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	99.93
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	99.93
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	99.93
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	99.93
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	99.93
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	99.93
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.93
KOG0055\|consensus		1228		99.93
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	99.93
cd03216		163	ABC_Carb_Monos_I This family represents the domain	99.93
PRK10522		547	multidrug transporter membrane component/ATP-bindi	99.93
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	99.93
cd03299		235	ABC_ModC_like Archeal protein closely related to M	99.93
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	99.93
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	99.93
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	99.93
COG4172		534	ABC-type uncharacterized transport system, duplica	99.93
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	99.93
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	99.93
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	99.93
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.93
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	99.93
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	99.93
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	99.93
KOG0058\|consensus		716		99.93
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	99.93
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	99.93
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	99.93
COG4525		259	TauB ABC-type taurine transport system, ATPase com	99.93
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	99.93
COG0410		237	LivF ABC-type branched-chain amino acid transport	99.93
KOG0996\|consensus		1293		99.93
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	99.93
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	99.93
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	99.93
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	99.93
cd03215		182	ABC_Carb_Monos_II This family represents domain II	99.93
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	99.93
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	99.93
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	99.93
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.93
PRK10535		648	macrolide transporter ATP-binding /permease protei	99.93
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	99.92
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	99.92
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.92
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	99.92
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	99.92
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	99.92
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	99.92
PLN03232		1495	ABC transporter C family member; Provisional	99.92
PRK13546		264	teichoic acids export protein ATP-binding subunit;	99.92
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.92
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.92
COG4172		534	ABC-type uncharacterized transport system, duplica	99.92
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	99.92
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	99.92
PLN03130		1622	ABC transporter C family member; Provisional	99.92
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.92
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.92
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	99.92
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	99.92
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	99.92
PTZ00243		1560	ABC transporter; Provisional	99.92
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	99.91
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.91
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.91
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.91
PRK13409		590	putative ATPase RIL; Provisional	99.91
PLN03073		718	ABC transporter F family; Provisional	99.91
PRK11147		635	ABC transporter ATPase component; Reviewed	99.91
COG4778		235	PhnL ABC-type phosphonate transport system, ATPase	99.91
KOG0055\|consensus		1228		99.91
KOG0018\|consensus		1141		99.91
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.91
cd03270		226	ABC_UvrA_I The excision repair protein UvrA domain	99.91
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.91
PLN03211		659	ABC transporter G-25; Provisional	99.91
PRK11147		635	ABC transporter ATPase component; Reviewed	99.9
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	99.9
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	99.9
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.9
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.9
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	99.9
PLN03073		718	ABC transporter F family; Provisional	99.9
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.9
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	99.9
TIGR00955		617	3a01204 The Eye Pigment Precursor Transporter (EPP	99.9
PRK13409		590	putative ATPase RIL; Provisional	99.9
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.9
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	99.89
COG0488		530	Uup ATPase components of ABC transporters with dup	99.89
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	99.89
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	99.89
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.88
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	99.88
COG3845		501	ABC-type uncharacterized transport systems, ATPase	99.88
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	99.88
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	99.88
PLN03140		1470	ABC transporter G family member; Provisional	99.88
COG4133		209	CcmA ABC-type transport system involved in cytochr	99.88
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	99.88
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.87
cd03271		261	ABC_UvrA_II The excision repair protein UvrA domai	99.87
PLN03232		1495	ABC transporter C family member; Provisional	99.87
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.86
PLN03130		1622	ABC transporter C family member; Provisional	99.86
KOG0056\|consensus		790		99.86
cd03274		212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	99.86
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.85
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.84
COG5265		497	ATM1 ABC-type transport system involved in Fe-S cl	99.83
PTZ00243		1560	ABC transporter; Provisional	99.83
PLN03140		1470	ABC transporter G family member; Provisional	99.83
COG4674		249	Uncharacterized ABC-type transport system, ATPase	99.82
COG4586		325	ABC-type uncharacterized transport system, ATPase	99.82
COG4136		213	ABC-type uncharacterized transport system, ATPase	99.82
COG4167		267	SapF ABC-type antimicrobial peptide transport syst	99.82
cd03272		243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	99.81
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	99.81
COG0488		530	Uup ATPase components of ABC transporters with dup	99.81
KOG0061\|consensus		613		99.81
PF02463		220	SMC_N: RecF/RecN/SMC N terminal domain; InterPro:	99.81
cd03279		213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	99.8
PRK03918		880	chromosome segregation protein; Provisional	99.77
cd03275		247	ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein	99.77
PF00005		137	ABC_tran: ABC transporter This structure is on hol	99.77
cd03276		198	ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein	99.76
KOG0054\|consensus		1381		99.75
KOG0054\|consensus		1381		99.75
COG4615		546	PvdE ABC-type siderophore export system, fused ATP	99.74
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.74
PHA02562		562	46 endonuclease subunit; Provisional	99.73
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.72
cd03277		213	ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein	99.72
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.72
KOG0059\|consensus		885		99.71
KOG0927\|consensus		614		99.7
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	99.7
KOG0062\|consensus		582		99.69
cd03240		204	ABC_Rad50 The catalytic domains of Rad50 are simil	99.69
PRK01156		895	chromosome segregation protein; Provisional	99.69
cd03241		276	ABC_RecN RecN ATPase involved in DNA repair; ABC (	99.69
cd03239		178	ABC_SMC_head The structural maintenance of chromos	99.68
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.68
COG4138		248	BtuD ABC-type cobalamin transport system, ATPase c	99.67
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.65
KOG0927\|consensus		614		99.64
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	99.64
COG4178		604	ABC-type uncharacterized transport system, permeas	99.64
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	99.63
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.63
PRK10869		553	recombination and repair protein; Provisional	99.63
PRK02224		880	chromosome segregation protein; Provisional	99.63
KOG0062\|consensus		582		99.6
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.59
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	99.58
KOG0065\|consensus		1391		99.58
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.57
KOG0066\|consensus		807		99.55
COG4170		330	SapD ABC-type antimicrobial peptide transport syst	99.55
cd03227		162	ABC_Class2 ABC-type Class 2 contains systems invol	99.54
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	99.51
cd03285		222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	99.42
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	99.42
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	99.4
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	99.38
KOG0060\|consensus		659		99.37
PRK10246		1047	exonuclease subunit SbcC; Provisional	99.37
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	99.33
COG3845		501	ABC-type uncharacterized transport systems, ATPase	99.3
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	99.28
KOG0066\|consensus		807		99.27
KOG0063\|consensus		592		99.27
cd03242		270	ABC_RecF RecF is a recombinational DNA repair ATPa	99.21
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	99.17
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	99.08
KOG0064\|consensus		728		99.07
PRK00064		361	recF recombination protein F; Reviewed	99.04
cd03284		216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	99.04
KOG2355\|consensus		291		99.02
PF13304		303	AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T	98.99
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	98.97
KOG0063\|consensus		592		98.9
KOG0065\|consensus		1391		98.89
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	98.89
COG3910		233	Predicted ATPase [General function prediction only	98.89
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	98.87
TIGR00611		365	recf recF protein. All proteins in this family for	98.86
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	98.82
PF13558		90	SbcCD_C: Putative exonuclease SbcCD, C subunit; PD	98.78
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	98.77
PRK08533		230	flagellar accessory protein FlaH; Reviewed	98.51
PRK14079		349	recF recombination protein F; Provisional	98.5
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	98.47
PF13175		415	AAA_15: AAA ATPase domain	98.45
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	98.35
PRK00409		782	recombination and DNA strand exchange inhibitor pr	98.35
cd01128		249	rho_factor Transcription termination factor rho is	98.34
cd03286		218	ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS	98.33
KOG0979\|consensus		1072		98.29
PF13514		1111	AAA_27: AAA domain	98.24
PF13166		712	AAA_13: AAA domain	98.18
KOG0250\|consensus		1074		98.16
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	98.14
PRK13695		174	putative NTPase; Provisional	98.05
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	98.02
COG4637		373	Predicted ATPase [General function prediction only	97.98
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	97.93
KOG0962\|consensus		1294		97.93
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	97.5
PRK06793		432	fliI flagellum-specific ATP synthase; Validated	97.07
COG4694		758	Uncharacterized protein conserved in bacteria [Fun	97.04
PRK13830		818	conjugal transfer protein TrbE; Provisional	97.03
COG1195		363	RecF Recombinational DNA repair ATPase (RecF pathw	96.98
TIGR03238		504	dnd_assoc_3 dnd system-associated protein 3. cereu	96.84
PRK07721		438	fliI flagellum-specific ATP synthase; Validated	96.74
PRK06067		234	flagellar accessory protein FlaH; Validated	96.66
PRK13891		852	conjugal transfer protein TrbE; Provisional	96.57
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	96.48
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	96.17
COG3950		440	Predicted ATP-binding protein involved in virulenc	96.09
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.06
PRK05399		854	DNA mismatch repair protein MutS; Provisional	95.58
PRK08699		325	DNA polymerase III subunit delta'; Validated	95.52
COG4717		984	Uncharacterized conserved protein [Function unknow	95.2
PRK13873		811	conjugal transfer ATPase TrbE; Provisional	95.08
PRK04778		569	septation ring formation regulator EzrA; Provision	94.96
PRK04863		1486	mukB cell division protein MukB; Provisional	94.94
COG3593		581	Predicted ATP-dependent endonuclease of the OLD fa	94.42
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.35
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	94.33
PRK13898		800	type IV secretion system ATPase VirB4; Provisional	94.11
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	93.42
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	92.72
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	92.23
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	92.08
smart00382		148	AAA ATPases associated with a variety of cellular	89.65
TIGR01070		840	mutS1 DNA mismatch repair protein MutS.	89.51
PF00488		235	MutS_V: MutS domain V C-terminus.; InterPro: IPR00	89.43
COG4938		374	Uncharacterized conserved protein [Function unknow	88.49
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	87.63
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	87.23
PRK07471		365	DNA polymerase III subunit delta'; Validated	86.58
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	85.52
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	85.51

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

Probab=100.00  E-value=2e-42  Score=303.05  Aligned_cols=192  Identities=21%  Similarity=0.284  Sum_probs=156.4

Q ss_pred             HHHHHhhcccccccccchhhHHHHHhhhhcccccceeeeccceee------chhhHHHHhhhhh--ccchhHHHhhHHHH
Q psy17516         32 LRNEENQFKVGAMVKAPLKTLLFISMKKYLGSMSSFSVKVGAMVK------APLRTLLFISMEA--MTKKSIVESDRAKL  103 (264)
Q Consensus        32 ~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~v~~~v~~Ge~~~------sGKSTLl~~l~~l--~~~~~~~~~~~~~l  103 (264)
                      .+++.+.|..+...+.+             ++++||+|++||+++      |||||||+++.++  |+.|.+.+.+.   
T Consensus         4 ~~~v~k~y~~~~~~~~~-------------L~~v~l~i~~Ge~vaI~GpSGSGKSTLLniig~ld~pt~G~v~i~g~---   67 (226)
T COG1136           4 LKNVSKIYGLGGEKVEA-------------LKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLDKPTSGEVLINGK---   67 (226)
T ss_pred             EeeeEEEeccCCcceEe-------------cccceEEEcCCCEEEEECCCCCCHHHHHHHHhcccCCCCceEEECCE---
Confidence            45667777755433334             455999999999998      9999999999665  45666677774   


Q ss_pred             HHHHHhhhHHHHHHHHHHHHHhhhhhhhHHHh--hcCCCcCCCC----------CC-chhhHHHhHHHHcCCCcccc-cc
Q psy17516        104 LKVIEELDEKKKIALREAWLKVNTDFGSIFSL--LLPGSQAKLS----------PP-AGKDILDGLEVNVAFGGLWK-ES  169 (264)
Q Consensus       104 ~~~I~~l~~~~~~~~~~~~~~v~~~f~~vf~~--L~~g~~~~l~----------~~-~~~~~~~~l~~~v~l~~~~~-~~  169 (264)
                        ++..+++.++..||      ++++|+|||.  |+|..++..+          .. ...+....++..+|+.+... ++
T Consensus        68 --d~~~l~~~~~~~~R------~~~iGfvFQ~~nLl~~ltv~ENv~lpl~~~~~~~~~~~~~~~~l~~~lgl~~~~~~~~  139 (226)
T COG1136          68 --DLTKLSEKELAKLR------RKKIGFVFQNFNLLPDLTVLENVELPLLIAGKSAGRRKRAAEELLEVLGLEDRLLKKK  139 (226)
T ss_pred             --EcCcCCHHHHHHHH------HHhEEEECccCCCCCCCCHHHHHHhHHHHcCCChhHHHHHHHHHHHhcCChhhhccCC
Confidence              38889988889998      4788999995  7777765211          11 22345678888889997766 88


Q ss_pred             cCCCCHHHHHHHHHHHHHHHhhcCCCCEEEeecCCCCCCHHHHHHHHHHHHHhhc--CCeEEEEEeCcchHhhccceeEE
Q psy17516        170 LGELSGGQRSLVALSLVLAMLLFKPAPLYILDEVDAALDLSHTQNIGQMLKRHFK--TSQFIIVSLKEGMFSNANVIFRT  247 (264)
Q Consensus       170 ~~~LSGGekqrvaiA~~la~~l~~~~~illlDEPta~LD~~~~~~i~~ll~~~~~--~~q~IiVTH~~~~~~~ad~l~~v  247 (264)
                      |.+||||||||||||||+    +++|+++|+||||++||..+...|+++++++++  ++++|+||||+.++.+|||+|. 
T Consensus       140 p~eLSGGqqQRVAIARAL----~~~P~iilADEPTgnLD~~t~~~V~~ll~~~~~~~g~tii~VTHd~~lA~~~dr~i~-  214 (226)
T COG1136         140 PSELSGGQQQRVAIARAL----INNPKIILADEPTGNLDSKTAKEVLELLRELNKERGKTIIMVTHDPELAKYADRVIE-  214 (226)
T ss_pred             chhcCHHHHHHHHHHHHH----hcCCCeEEeeCccccCChHHHHHHHHHHHHHHHhcCCEEEEEcCCHHHHHhCCEEEE-
Confidence            999999999999999886    489999999999999999999999999999874  6789999999999999999999 


Q ss_pred             EeeCCe
Q psy17516        248 KFVDGN  253 (264)
Q Consensus       248 ~~~~g~  253 (264)
                       +.||.
T Consensus       215 -l~dG~  219 (226)
T COG1136         215 -LKDGK  219 (226)
T ss_pred             -EeCCe
Confidence             77987

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0933\|consensus	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0964\|consensus	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0057\|consensus	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>KOG0058\|consensus	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0996\|consensus	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>KOG0018\|consensus	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>KOG0056\|consensus	Back alignment and domain information

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>KOG0061\|consensus	Back alignment and domain information

>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []	Back alignment and domain information

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>KOG0059\|consensus	Back alignment and domain information

>KOG0927\|consensus	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>KOG0062\|consensus	Back alignment and domain information

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>KOG0927\|consensus	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0062\|consensus	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>KOG0065\|consensus	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG0066\|consensus	Back alignment and domain information

>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>KOG0060\|consensus	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>KOG0066\|consensus	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>KOG0064\|consensus	Back alignment and domain information

>PRK00064 recF recombination protein F; Reviewed	Back alignment and domain information

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes	Back alignment and domain information

>KOG2355\|consensus	Back alignment and domain information

>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>KOG0065\|consensus	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>TIGR00611 recf recF protein	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK14079 recF recombination protein F; Provisional	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>PF13175 AAA_15: AAA ATPase domain	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes	Back alignment and domain information

>KOG0979\|consensus	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>KOG0250\|consensus	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>COG4637 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>KOG0962\|consensus	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK06793 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>COG4694 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK13830 conjugal transfer protein TrbE; Provisional	Back alignment and domain information

>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3	Back alignment and domain information

>PRK07721 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK13891 conjugal transfer protein TrbE; Provisional	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only]	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK05399 DNA mismatch repair protein MutS; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13873 conjugal transfer ATPase TrbE; Provisional	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK13898 type IV secretion system ATPase VirB4; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>TIGR01070 mutS1 DNA mismatch repair protein MutS	Back alignment and domain information

>PF00488 MutS_V: MutS domain V C-terminus	Back alignment and domain information

>COG4938 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		264
1xew_Y		172	Structural Biochemistry Of Atp-Driven Dimerization		7e-16
1xex_B		172	Structural Biochemistry Of Atp-Driven Dimerization		2e-15
3zgx_A		426	Crystal Structure Of The Kleisin-n Smc Interface In		6e-15
3kta_B		173	Structural Basis For Adenylate Kinase Activity In A		8e-14
4i99_A		354	Crystal Structure Of The Smchead Bound To The C-win		5e-13
1e69_A		322	Smc Head Domain From Thermotoga Maritima Length = 3		5e-12
1w1w_A		430	Sc Smc1hd:scc1-c Complex, Atpgs Length = 430		4e-10

>pdb|1XEW|Y Chain Y, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172