Diaphorina citri psyllid: psy17526


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MNAHSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGHYCESF
cccccccccccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHccccccccccccccccc
*******CQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGHYCESF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAHSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGHYCESF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 24 confidentQ8CFJ9
WD repeat-containing protein 24 homolog confidentQ54JS5
WD repeat-containing protein 24 confidentQ96S15

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035859 [CC]Seh1-associated complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0097042 [CC]extrinsic to fungal-type vacuolar membraneprobableGO:0000324, GO:0000323, GO:0000322, GO:0000306, GO:0000329, GO:0019898, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0005773, GO:0016020, GO:0005774, GO:0044437, GO:0031312, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NW0, chain A
Confidence level:confident
Coverage over the Query: 24-64
View the alignment between query and template
View the model in PyMOL
Template: 4AP4, chain A
Confidence level:probable
Coverage over the Query: 3-61
View the alignment between query and template
View the model in PyMOL