Diaphorina citri psyllid: psy17547


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
YCDCFANGEFCYQCNCNSCFNNIEHEDDRHHAIRQCLERNPNAFRPKIGKCLVGEGERRHTKGCNCKRSGCLKNYCECYEAGARTLEPNGIRPRKPCNCTKSMCLKLYCDCFANGEFCYQCNCNSCFNNIEHEDDRHHAIRQCLERNPNAFRPKIGKCLVGEGERRHTKGCNCKRSGCLKNYCECY
cccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
YCDCFANGEFCYQCNCNSCFNNIEHEDDRHHAIRQCLERNPNAFRPKIG*************GCNCKRSGCLKNYCECYEAGARTLEPNGIRPRKPCNCTKSMCLKLYCDCFANGEFCYQCNCNSCFNNIEHEDDRHHAIRQCLERNPNAFRPKIGK************GCNCKRSGCLKNYCECY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YCDCFANGEFCYQCNCNSCFNNIEHEDDRHHAIRQCLERNPNAFRPKIGKCLVGEGERRHTKGCNCKRSGCLKNYCECYEAGARTLEPNGIRPRKPCNCTKSMCLKLYCDCFANGEFCYQCNCNSCFNNIEHEDDRHHAIRQCLERNPNAFRPKIGKCLVGEGERRHTKGCNCKRSGCLKNYCECY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein lin-54 homolog Component of the DREAM complex, a multiprotein complex that can both act as a transcription activator or repressor depending on the context.confidentQ08CM4
Protein lin-54 homolog Component of the DREAM complex, a multiprotein complex that can both act as a transcription activator or repressor depending on the context. In G0 phase, the complex binds to more than 800 promoters and is required for repression of E2F target genes. In S phase, the complex selectively binds to the promoters of G2/M genes whose products are required for mitosis and participates in their cell cycle dependent activation. In the complex, acts as a DNA-binding protein that binds the promoter of CDK1 in a sequence-specific manner.confidentQ5RBN8
Protein lin-54 Synthetic multivulva class B (synMuvB) protein. SynMuvB proteins are required to repress the induction of vulval development by Ras signaling and probably act by forming the multiprotein DRM complex that repress transcription.confidentQ95QD7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030849 [CC]autosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0070176 [CC]DRM complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0017053, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0001046 [MF]core promoter sequence-specific DNA bindingprobableGO:0044212, GO:0003676, GO:0043565, GO:0097159, GO:0000975, GO:0001067, GO:0000976, GO:0005488, GO:0001047, GO:0003677, GO:0003674, GO:1901363
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0040027 [BP]negative regulation of vulval developmentprobableGO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0031523 [CC]Myb complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LUA, chain A
Confidence level:probable
Coverage over the Query: 103-131
View the alignment between query and template
View the model in PyMOL
Template: 2LUA, chain A
Confidence level:probable
Coverage over the Query: 2-24
View the alignment between query and template
View the model in PyMOL