Diaphorina citri psyllid: psy1755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHSDFNIKPIV
ccEEccHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccc
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHS****K*IV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHSDFNIKPIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Feline leukemia virus subgroup C receptor-related protein 2 Acts as an importer of heme. Also acts as a transporter for a calcium-chelator complex, important for growth and calcium metabolism.confidentP60815
Feline leukemia virus subgroup C receptor-related protein 2 Acts as an importer of heme. Also acts as a transporter for a calcium-chelator complex, important for growth and calcium metabolism.confidentQ91X85

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0015232 [MF]heme transporter activityprobableGO:0051184, GO:0003674, GO:0005215
GO:0015886 [BP]heme transportprobableGO:1901678, GO:0051181, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O7Q, chain A
Confidence level:confident
Coverage over the Query: 4-62
View the alignment between query and template
View the model in PyMOL
Template: 2XUT, chain A
Confidence level:probable
Coverage over the Query: 4-67
View the alignment between query and template
View the model in PyMOL