Psyllid ID: psy1755


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHSDFNIKPIV
ccEEccHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccc
ccHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcc
msllgsgrsffmtgyLPVGFELAaeltypepegtssgllnaSAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLltliippdlrrqaahsdfnikpiv
msllgsgrsfFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDlrrqaahsdfnikpiv
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIalclalvlgtlltliippdlRRQAAHSDFNIKPIV
********SFFMTGYLPVGFELAAELTYPE****SSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDL***************
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHS****K*IV
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHSDFNIKPIV
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHSDFNIKPIV
oooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLTLIIPPDLRRQAAHSDFNIKPIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
P60815546 Feline leukemia virus sub yes N/A 0.844 0.159 0.632 1e-25
Q91X85551 Feline leukemia virus sub yes N/A 0.844 0.157 0.620 2e-24
Q9UPI3526 Feline leukemia virus sub no N/A 0.844 0.165 0.620 6e-24
O01735586 Uncharacterized MFS-type no N/A 0.834 0.146 0.604 1e-23
Q9N1F2560 Feline leukemia virus sub N/A N/A 0.902 0.166 0.561 2e-23
Q9Y5Y0555 Feline leukemia virus sub no N/A 0.902 0.167 0.552 3e-23
Q9ES43560 Feline leukemia virus sub N/A N/A 0.834 0.153 0.528 1e-18
Q28FF3482 Major facilitator superfa no N/A 0.446 0.095 0.434 0.0006
>sp|P60815|FLVC2_RAT Feline leukemia virus subgroup C receptor-related protein 2 OS=Rattus norvegicus GN=Flvcr2 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 64/87 (73%)

Query: 10  FFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIA 69
           FFMTGYLP+GFE A ELTYPE EG SSGLLN SAQVFGI+FT+  GQ+   +G +  NI 
Sbjct: 430 FFMTGYLPLGFEFAVELTYPESEGVSSGLLNVSAQVFGIIFTISQGQIIDNYGSVPGNIF 489

Query: 70  LCLALVLGTLLTLIIPPDLRRQAAHSD 96
           LC+ L LG+ LT  I  DLRRQ A+ D
Sbjct: 490 LCVFLALGSALTAFIKSDLRRQRANKD 516




Acts as an importer of heme. Also acts as a transporter for a calcium-chelator complex, important for growth and calcium metabolism.
Rattus norvegicus (taxid: 10116)
>sp|Q91X85|FLVC2_MOUSE Feline leukemia virus subgroup C receptor-related protein 2 OS=Mus musculus GN=Flvcr2 PE=1 SV=2 Back     alignment and function description
>sp|Q9UPI3|FLVC2_HUMAN Feline leukemia virus subgroup C receptor-related protein 2 OS=Homo sapiens GN=FLVCR2 PE=1 SV=1 Back     alignment and function description
>sp|O01735|YC91_CAEEL Uncharacterized MFS-type transporter C09D4.1 OS=Caenorhabditis elegans GN=C09D4.1 PE=3 SV=2 Back     alignment and function description
>sp|Q9N1F2|FLVC1_FELCA Feline leukemia virus subgroup C receptor-related protein 1 OS=Felis catus GN=FLVCR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ES43|FLVC1_MUSDU Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus dunni GN=Flvcr1 PE=2 SV=1 Back     alignment and function description
>sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
350418906 450 PREDICTED: feline leukemia virus subgrou 0.825 0.188 0.729 5e-28
350418909 452 PREDICTED: feline leukemia virus subgrou 0.825 0.188 0.729 7e-28
380025042 460 PREDICTED: uncharacterized MFS-type tran 0.796 0.178 0.707 1e-27
328781662 459 PREDICTED: uncharacterized MFS-type tran 0.844 0.189 0.678 1e-27
340713946 450 PREDICTED: uncharacterized MFS-type tran 0.825 0.188 0.705 2e-27
194863762 481 GG10727 [Drosophila erecta] gi|190662468 0.864 0.185 0.677 2e-27
195474438 482 GE23783 [Drosophila yakuba] gi|194175599 0.864 0.184 0.677 2e-27
19921750 482 CG1358, isoform A [Drosophila melanogast 0.864 0.184 0.677 2e-27
195332175 482 GM20774 [Drosophila sechellia] gi|194124 0.864 0.184 0.677 2e-27
195581272 482 GD10235 [Drosophila simulans] gi|1941924 0.864 0.184 0.677 2e-27
>gi|350418906|ref|XP_003492007.1| PREDICTED: feline leukemia virus subgroup C receptor-related protein 2-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 62/85 (72%), Positives = 68/85 (80%)

Query: 10  FFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFGDIVANIA 69
           FFMTGYLPVGFE AAELTYPEPEGTS+GLLNA  QVFGI+FT++YG     +GD  ANI 
Sbjct: 365 FFMTGYLPVGFEFAAELTYPEPEGTSTGLLNAVCQVFGIVFTILYGYSLNEWGDFWANIF 424

Query: 70  LCLALVLGTLLTLIIPPDLRRQAAH 94
           LC  L LGTLLT+IIP DLRRQ A 
Sbjct: 425 LCGTLALGTLLTIIIPNDLRRQKAK 449




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350418909|ref|XP_003492008.1| PREDICTED: feline leukemia virus subgroup C receptor-related protein 2-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380025042|ref|XP_003696290.1| PREDICTED: uncharacterized MFS-type transporter C09D4.1-like [Apis florea] Back     alignment and taxonomy information
>gi|328781662|ref|XP_392360.3| PREDICTED: uncharacterized MFS-type transporter C09D4.1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|340713946|ref|XP_003395494.1| PREDICTED: uncharacterized MFS-type transporter C09D4.1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|194863762|ref|XP_001970601.1| GG10727 [Drosophila erecta] gi|190662468|gb|EDV59660.1| GG10727 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195474438|ref|XP_002089498.1| GE23783 [Drosophila yakuba] gi|194175599|gb|EDW89210.1| GE23783 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|19921750|ref|NP_610301.1| CG1358, isoform A [Drosophila melanogaster] gi|24586316|ref|NP_724584.1| CG1358, isoform B [Drosophila melanogaster] gi|24586318|ref|NP_724585.1| CG1358, isoform C [Drosophila melanogaster] gi|320543616|ref|NP_001188873.1| CG1358, isoform D [Drosophila melanogaster] gi|7304188|gb|AAF59224.1| CG1358, isoform A [Drosophila melanogaster] gi|17861620|gb|AAL39287.1| GH15861p [Drosophila melanogaster] gi|21645594|gb|AAM71101.1| CG1358, isoform B [Drosophila melanogaster] gi|21645595|gb|AAM71102.1| CG1358, isoform C [Drosophila melanogaster] gi|220947414|gb|ACL86250.1| CG1358-PA [synthetic construct] gi|220956870|gb|ACL90978.1| CG1358-PA [synthetic construct] gi|283046860|gb|ADB04946.1| MIP14896p [Drosophila melanogaster] gi|318068531|gb|ADV37122.1| CG1358, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195332175|ref|XP_002032774.1| GM20774 [Drosophila sechellia] gi|194124744|gb|EDW46787.1| GM20774 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195581272|ref|XP_002080458.1| GD10235 [Drosophila simulans] gi|194192467|gb|EDX06043.1| GD10235 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
FB|FBgn0033196482 CG1358 [Drosophila melanogaste 0.854 0.182 0.608 6.2e-22
RGD|735098546 Flvcr2 "feline leukemia virus 0.844 0.159 0.517 7.7e-18
ZFIN|ZDB-GENE-041210-312495 flvcr2b "feline leukemia virus 0.825 0.171 0.517 1.3e-17
UNIPROTKB|H7C3Z2354 FLVCR1 "Feline leukemia virus 0.621 0.180 0.656 1.3e-17
UNIPROTKB|F1NA70442 FLVCR2 "Uncharacterized protei 0.825 0.192 0.529 2e-17
UNIPROTKB|E1B7A6556 FLVCR1 "Uncharacterized protei 0.572 0.106 0.677 4.6e-17
UNIPROTKB|E2RSI2556 FLVCR1 "Uncharacterized protei 0.640 0.118 0.636 4.6e-17
UNIPROTKB|F1S2X6559 FLVCR1 "Uncharacterized protei 0.572 0.105 0.677 4.6e-17
UNIPROTKB|E2QRV7523 FLVCR2 "Uncharacterized protei 0.844 0.166 0.505 5.1e-17
UNIPROTKB|E1B772529 FLVCR2 "Uncharacterized protei 0.893 0.173 0.494 5.2e-17
FB|FBgn0033196 CG1358 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 6.2e-22, P = 6.2e-22
 Identities = 56/92 (60%), Positives = 59/92 (64%)

Query:     2 SLLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAF 61
             SLLG    FFMTGYLPVGFE  AELT+PEPEGTSSGLLNASAQ FGI FT+ Y +LFT F
Sbjct:   384 SLLG----FFMTGYLPVGFEFGAELTFPEPEGTSSGLLNASAQTFGICFTLFYSELFTTF 439

Query:    62 GDIVANIXXXXXXXXXXXXXXXXXXXXRRQAA 93
             GDI ANI                    RRQ A
Sbjct:   440 GDIAANITMAVMLIVGTIITAITQSDLRRQNA 471




GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
RGD|735098 Flvcr2 "feline leukemia virus subgroup C cellular receptor family, member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-312 flvcr2b "feline leukemia virus subgroup C cellular receptor family, member 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H7C3Z2 FLVCR1 "Feline leukemia virus subgroup C receptor-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA70 FLVCR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7A6 FLVCR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSI2 FLVCR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2X6 FLVCR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRV7 FLVCR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B772 FLVCR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91X85FLVC2_MOUSENo assigned EC number0.62060.84460.1578yesN/A
P60815FLVC2_RATNo assigned EC number0.63210.84460.1593yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
KOG2563|consensus480 99.84
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.65
PRK05122399 major facilitator superfamily transporter; Provisi 97.44
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.33
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.26
PRK03699394 putative transporter; Provisional 97.11
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.04
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.02
COG0738422 FucP Fucose permease [Carbohydrate transport and m 97.0
PRK11663434 regulatory protein UhpC; Provisional 96.94
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 96.9
TIGR00892455 2A0113 monocarboxylate transporter 1. 96.78
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 96.72
PRK10489417 enterobactin exporter EntS; Provisional 96.7
TIGR00900 365 2A0121 H+ Antiporter protein. 96.69
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 96.69
TIGR01272310 gluP glucose/galactose transporter. Disruption of 96.63
TIGR00893399 2A0114 d-galactonate transporter. 96.52
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 96.51
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 96.51
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 96.49
TIGR00898505 2A0119 cation transport protein. 96.48
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 96.45
TIGR00897402 2A0118 polyol permease family. This family of prot 96.45
TIGR00893 399 2A0114 d-galactonate transporter. 96.44
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 96.4
PRK09874408 drug efflux system protein MdtG; Provisional 96.36
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 96.34
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 96.31
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 96.1
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 96.09
PRK10642490 proline/glycine betaine transporter; Provisional 96.06
PRK12382392 putative transporter; Provisional 96.03
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 96.02
PRK03633381 putative MFS family transporter protein; Provision 95.99
TIGR00891 405 2A0112 putative sialic acid transporter. 95.92
COG2270438 Permeases of the major facilitator superfamily [Ge 95.89
PRK11010491 ampG muropeptide transporter; Validated 95.85
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.77
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 95.77
PRK09528420 lacY galactoside permease; Reviewed 95.57
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 95.49
PRK11195393 lysophospholipid transporter LplT; Provisional 95.37
PRK10077479 xylE D-xylose transporter XylE; Provisional 95.32
PRK11043 401 putative transporter; Provisional 95.31
PRK10473 392 multidrug efflux system protein MdtL; Provisional 95.26
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 95.08
TIGR00889418 2A0110 nucleoside transporter. This family of prot 95.07
PRK10213 394 nepI ribonucleoside transporter; Reviewed 94.99
PRK11010 491 ampG muropeptide transporter; Validated 94.99
TIGR00895 398 2A0115 benzoate transport. 94.98
PRK03545 390 putative arabinose transporter; Provisional 94.98
PRK09705393 cynX putative cyanate transporter; Provisional 94.96
PRK09874 408 drug efflux system protein MdtG; Provisional 94.94
PRK15011393 sugar efflux transporter B; Provisional 94.91
PRK12307 426 putative sialic acid transporter; Provisional 94.83
PRK03893496 putative sialic acid transporter; Provisional 94.77
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 94.74
TIGR00892 455 2A0113 monocarboxylate transporter 1. 94.73
KOG2504|consensus509 94.73
PRK03545390 putative arabinose transporter; Provisional 94.7
PTZ00207 591 hypothetical protein; Provisional 94.7
PRK03893 496 putative sialic acid transporter; Provisional 94.69
PRK12307426 putative sialic acid transporter; Provisional 94.54
PLN00028476 nitrate transmembrane transporter; Provisional 94.51
PRK10489 417 enterobactin exporter EntS; Provisional 94.5
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.5
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 94.49
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 94.46
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 94.38
PRK10091382 MFS transport protein AraJ; Provisional 94.33
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 94.25
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.15
PRK15075434 citrate-proton symporter; Provisional 94.13
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 94.07
PRK09584 500 tppB putative tripeptide transporter permease; Rev 94.05
TIGR00898 505 2A0119 cation transport protein. 94.03
PRK11902 402 ampG muropeptide transporter; Reviewed 94.02
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 93.93
PRK09952438 shikimate transporter; Provisional 93.9
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 93.87
PRK15011 393 sugar efflux transporter B; Provisional 93.62
PRK10054 395 putative transporter; Provisional 93.58
PRK11663 434 regulatory protein UhpC; Provisional 93.57
PRK10504471 putative transporter; Provisional 93.53
PRK11043401 putative transporter; Provisional 93.48
PRK10207 489 dipeptide/tripeptide permease B; Provisional 93.46
PRK14995 495 methyl viologen resistance protein SmvA; Provision 93.45
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 93.42
PRK11652 394 emrD multidrug resistance protein D; Provisional 93.41
PRK10077 479 xylE D-xylose transporter XylE; Provisional 93.38
TIGR00901 356 2A0125 AmpG-related permease. 93.37
PRK10207489 dipeptide/tripeptide permease B; Provisional 93.28
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 93.28
PRK11646 400 multidrug resistance protein MdtH; Provisional 93.22
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 93.12
PRK10504 471 putative transporter; Provisional 93.12
PRK10133438 L-fucose transporter; Provisional 93.06
PRK15402406 multidrug efflux system translocase MdfA; Provisio 93.05
PRK10091 382 MFS transport protein AraJ; Provisional 92.98
PRK15462 493 dipeptide/tripeptide permease D; Provisional 92.88
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 92.84
PRK11652394 emrD multidrug resistance protein D; Provisional 92.79
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 92.74
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 92.68
TIGR00896 355 CynX cyanate transporter. This family of proteins 92.18
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 92.15
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 92.14
TIGR00897 402 2A0118 polyol permease family. This family of prot 92.1
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 92.03
PRK11902402 ampG muropeptide transporter; Reviewed 91.94
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 91.81
PRK11195 393 lysophospholipid transporter LplT; Provisional 91.64
PRK03699 394 putative transporter; Provisional 91.63
PRK09584500 tppB putative tripeptide transporter permease; Rev 91.58
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 91.48
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 91.38
TIGR00900365 2A0121 H+ Antiporter protein. 90.69
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 90.56
PRK11646400 multidrug resistance protein MdtH; Provisional 90.45
TIGR00881379 2A0104 phosphoglycerate transporter family protein 90.45
TIGR00891405 2A0112 putative sialic acid transporter. 90.3
PRK10054395 putative transporter; Provisional 89.64
PRK12382 392 putative transporter; Provisional 89.57
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 89.47
PRK09705 393 cynX putative cyanate transporter; Provisional 89.32
PRK10406432 alpha-ketoglutarate transporter; Provisional 89.31
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 88.97
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 88.91
PRK15403 413 multidrug efflux system protein MdtM; Provisional 88.71
KOG0569|consensus485 88.66
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 88.6
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 88.52
TIGR00788468 fbt folate/biopterin transporter. The only functio 88.23
KOG0252|consensus538 88.11
PRK10642 490 proline/glycine betaine transporter; Provisional 88.03
PRK15403413 multidrug efflux system protein MdtM; Provisional 88.01
PRK05122 399 major facilitator superfamily transporter; Provisi 87.54
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 87.33
TIGR00805 633 oat sodium-independent organic anion transporter. 87.22
PRK10406 432 alpha-ketoglutarate transporter; Provisional 86.97
PRK09952 438 shikimate transporter; Provisional 86.93
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 86.33
PRK10213394 nepI ribonucleoside transporter; Reviewed 85.88
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 85.67
PRK09528 420 lacY galactoside permease; Reviewed 85.1
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 84.74
PRK09848448 glucuronide transporter; Provisional 84.35
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 84.27
KOG0255|consensus 521 84.2
PLN00028 476 nitrate transmembrane transporter; Provisional 84.13
KOG2532|consensus 466 84.11
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 84.1
PRK03612 521 spermidine synthase; Provisional 83.78
TIGR00896355 CynX cyanate transporter. This family of proteins 83.5
PRK03633 381 putative MFS family transporter protein; Provision 83.22
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 83.06
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 82.96
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 82.9
TIGR00895398 2A0115 benzoate transport. 82.53
PRK09669444 putative symporter YagG; Provisional 82.53
TIGR00902382 2A0127 phenyl proprionate permease family protein. 82.15
PRK10473392 multidrug efflux system protein MdtL; Provisional 80.18
KOG3764|consensus 464 80.18
>KOG2563|consensus Back     alignment and domain information
Probab=99.84  E-value=2.5e-22  Score=159.00  Aligned_cols=95  Identities=45%  Similarity=0.724  Sum_probs=89.4

Q ss_pred             HHHHHHHHhhhchhHHHHHHHHhhcCCCCchhHHHHHHHHhhhhHHHHHHHHHhhhcccc----hhHHHHHHHHHHHHHH
Q psy1755           3 LLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILFTVVYGQLFTAFG----DIVANIALCLALVLGT   78 (103)
Q Consensus         3 v~~~l~G~f~~~~~Pi~lEla~E~tyPv~e~~ssgll~~~~qi~g~i~~~i~~~l~~~~~----~~~~~~~~~~~~~~~~   78 (103)
                      +.+.++|+|+.+.+|+++|+++|+|||++|++|+|+++.+||++|+++.++.+...++++    ....||.++..+.++.
T Consensus       364 ~t~~~~g~~~~~~~Pig~ElgvE~TyPv~E~tSsGll~~~gq~f~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~  443 (480)
T KOG2563|consen  364 TTCGLLGFFGTGYLPIGFELGVETTYPVAEGTSSGLLNLSGQIFGVILVFIMGILAEDLGPPGNTFPANIFLTVSALLGA  443 (480)
T ss_pred             hhHHHHHHhhcCCCCcceeeeeeeccccCCcccceeEEeehhHHHHHHHHHHHHHhhccCCCCCCccchhHhHHHHHHHH
Confidence            467899999999999999999999999999999999999999999999999999988887    6678999999999999


Q ss_pred             HHHhhcCCcchhhhhhhcC
Q psy1755          79 LLTLIIPPDLRRQAAHSDF   97 (103)
Q Consensus        79 il~~f~k~~~kR~~~e~~~   97 (103)
                      ++..|+|++|||+++|+..
T Consensus       444 ~lva~~r~~y~R~~~e~~~  462 (480)
T KOG2563|consen  444 ILVAFFRPDYRRLRAEAGN  462 (480)
T ss_pred             HHHhhhhhhHHhHhhhhcc
Confidence            9999999999999999753



>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 97.91
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 97.52
2xut_A524 Proton/peptide symporter family protein; transport 97.34
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 96.92
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 96.85
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 96.76
2xut_A 524 Proton/peptide symporter family protein; transport 96.74
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 96.49
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 96.06
2cfq_A417 Lactose permease; transport, transport mechanism, 95.81
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 95.61
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 86.54
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 81.99
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=97.91  E-value=6.1e-05  Score=55.70  Aligned_cols=85  Identities=15%  Similarity=0.110  Sum_probs=65.6

Q ss_pred             HHHHHHHHhhhchhHHHHHHHHhhcCCCCchhHHHHHHHHhhh-hHHHHHHHHHhhhcccchhHHHHHHHHHHHHHHHHH
Q psy1755           3 LLGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQV-FGILFTVVYGQLFTAFGDIVANIALCLALVLGTLLT   81 (103)
Q Consensus         3 v~~~l~G~f~~~~~Pi~lEla~E~tyPv~e~~ssgll~~~~qi-~g~i~~~i~~~l~~~~~~~~~~~~~~~~~~~~~il~   81 (103)
                      +...+.|++.+...|...-+..|...|...++..|+.+...++ .+.+.+.+.+.+.+..|..+..+...++.+++.++.
T Consensus       351 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~g~l~~~~g~~~~~~~~~~~~~~~~~~~  430 (451)
T 1pw4_A          351 ICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILL  430 (451)
T ss_dssp             HHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhchHHHHHHHHHHHhchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHH
Confidence            3456688888888999899999966555579999999999999 999999999999888775555566666666666665


Q ss_pred             hhcCCc
Q psy1755          82 LIIPPD   87 (103)
Q Consensus        82 ~f~k~~   87 (103)
                      ++.+++
T Consensus       431 ~~~~~~  436 (451)
T 1pw4_A          431 IVVMIG  436 (451)
T ss_dssp             HHHHHH
T ss_pred             HHHHhh
Confidence            555443



>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.27
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.4
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 94.59
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=98.27  E-value=2.1e-06  Score=61.26  Aligned_cols=98  Identities=16%  Similarity=0.126  Sum_probs=68.7

Q ss_pred             HHHHHHHhhhchhHHHHHHHHhhcCCCCchhHHHHHHHHhhhhHHHH-HHHHHhhhcccchhHHHHHHHHHHHHHHHHHh
Q psy1755           4 LGSGRSFFMTGYLPVGFELAAELTYPEPEGTSSGLLNASAQVFGILF-TVVYGQLFTAFGDIVANIALCLALVLGTLLTL   82 (103)
Q Consensus         4 ~~~l~G~f~~~~~Pi~lEla~E~tyPv~e~~ssgll~~~~qi~g~i~-~~i~~~l~~~~~~~~~~~~~~~~~~~~~il~~   82 (103)
                      ...+.|+...+..|....+..|...+...++..|+.+..++++|.+. +.+.+.+.+..|..+..+.+.++.+++.++..
T Consensus       349 ~~~~~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~~~~~~~  428 (447)
T d1pw4a_         349 CMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLI  428 (447)
T ss_dssp             HHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHHHH
Confidence            34567888888899999999996555455888999999999977654 67778888888866666666666666666555


Q ss_pred             hcCCcchhhhhhhcCCCCC
Q psy1755          83 IIPPDLRRQAAHSDFNIKP  101 (103)
Q Consensus        83 f~k~~~kR~~~e~~~~~~~  101 (103)
                      ++..+.||++.|..++.+|
T Consensus       429 ~~~~~~~~r~~~~~~e~~P  447 (447)
T d1pw4a_         429 VVMIGEKRRHEQLLQELVP  447 (447)
T ss_dssp             HHHHHHHHHHHGGGGGSCC
T ss_pred             HHHHhccccHHHHHHhCCC
Confidence            5544445555555554444



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure