Psyllid ID: psy17576
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| 226303480 | 934 | cGMP-dependent protein kinase [Drosophil | 0.910 | 0.098 | 0.913 | 2e-46 | |
| 157117039 | 827 | cgmp-dependent protein kinase [Aedes aeg | 0.910 | 0.111 | 0.902 | 2e-46 | |
| 157214 | 894 | cGMP-dependent protein kinase [Drosophil | 0.910 | 0.102 | 0.913 | 2e-46 | |
| 157204 | 934 | cGMP-dependent protein kinase [Drosophil | 0.910 | 0.098 | 0.913 | 2e-46 | |
| 17137768 | 894 | foraging, isoform C [Drosophila melanoga | 0.910 | 0.102 | 0.913 | 2e-46 | |
| 157220 | 894 | cGMP-dependent protein kinase [Drosophil | 0.910 | 0.102 | 0.913 | 2e-46 | |
| 226303476 | 894 | cGMP-dependent protein kinase [Drosophil | 0.910 | 0.102 | 0.913 | 2e-46 | |
| 17137770 | 934 | foraging, isoform E [Drosophila melanoga | 0.910 | 0.098 | 0.913 | 2e-46 | |
| 195052084 | 959 | GH13187 [Drosophila grimshawi] gi|193900 | 0.910 | 0.095 | 0.913 | 3e-46 | |
| 198474449 | 1502 | GA10020 [Drosophila pseudoobscura pseudo | 0.910 | 0.061 | 0.913 | 3e-46 |
| >gi|226303480|gb|ACO44431.1| cGMP-dependent protein kinase [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Score = 189 bits (480), Expect = 2e-46, Method: Composition-based stats.
Identities = 84/92 (91%), Positives = 87/92 (94%)
Query: 3 FSLNSQGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM 62
F+ Q GRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM
Sbjct: 768 FAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM 827
Query: 63 KTYNIILKGIDAIEFPRNITRNATALIKKLCR 94
+TYNIILKGIDAIEFPRNITRNA+ LIKKLCR
Sbjct: 828 RTYNIILKGIDAIEFPRNITRNASNLIKKLCR 859
|
Source: Drosophila melanogaster Species: Drosophila melanogaster Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157117039|ref|XP_001652946.1| cgmp-dependent protein kinase [Aedes aegypti] gi|108876230|gb|EAT40455.1| AAEL007826-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157214|gb|AAA28456.1| cGMP-dependent protein kinase [Drosophila melanogaster] gi|157222|gb|AAA28458.1| cGMP-dependent protein kinase [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|157204|gb|AAA28454.1| cGMP-dependent protein kinase [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|17137768|ref|NP_477489.1| foraging, isoform C [Drosophila melanogaster] gi|19549955|ref|NP_599146.1| foraging, isoform D [Drosophila melanogaster] gi|45552209|ref|NP_995627.1| foraging, isoform F [Drosophila melanogaster] gi|45552213|ref|NP_995629.1| foraging, isoform G [Drosophila melanogaster] gi|281364342|ref|NP_001162858.1| foraging, isoform K [Drosophila melanogaster] gi|10727353|gb|AAG22253.1| foraging, isoform D [Drosophila melanogaster] gi|22945290|gb|AAG22252.2| foraging, isoform C [Drosophila melanogaster] gi|28557663|gb|AAO45237.1| GH10421p [Drosophila melanogaster] gi|39840994|gb|AAD34763.2| LD21570p [Drosophila melanogaster] gi|45444947|gb|AAS64615.1| foraging, isoform F [Drosophila melanogaster] gi|45444948|gb|AAS64616.1| foraging, isoform G [Drosophila melanogaster] gi|272406876|gb|ACZ94149.1| foraging, isoform K [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|157220|gb|AAA28457.1| cGMP-dependent protein kinase [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|226303476|gb|ACO44429.1| cGMP-dependent protein kinase [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|17137770|ref|NP_477490.1| foraging, isoform E [Drosophila melanogaster] gi|62471593|ref|NP_001014464.1| foraging, isoform J [Drosophila melanogaster] gi|59799774|sp|P32023.3|KGP25_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2 forms cD5/T2; Short=cGK; AltName: Full=Foraging protein gi|10727354|gb|AAG22254.1| foraging, isoform E [Drosophila melanogaster] gi|61678273|gb|AAX52650.1| foraging, isoform J [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195052084|ref|XP_001993230.1| GH13187 [Drosophila grimshawi] gi|193900289|gb|EDV99155.1| GH13187 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|198474449|ref|XP_001356691.2| GA10020 [Drosophila pseudoobscura pseudoobscura] gi|198138398|gb|EAL33756.2| GA10020 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| FB|FBgn0000721 | 1088 | for "foraging" [Drosophila mel | 0.910 | 0.084 | 0.913 | 1.7e-41 | |
| UNIPROTKB|J9JHE0 | 489 | PRKG1 "Uncharacterized protein | 0.841 | 0.173 | 0.811 | 4.9e-37 | |
| UNIPROTKB|J9NWY9 | 474 | PRKG1 "Uncharacterized protein | 0.841 | 0.179 | 0.811 | 4.9e-37 | |
| UNIPROTKB|Q5JP05 | 283 | PRKG1 "cGMP-dependent protein | 0.841 | 0.300 | 0.811 | 4.9e-37 | |
| UNIPROTKB|F1SD02 | 459 | PRKG1 "Uncharacterized protein | 0.841 | 0.185 | 0.811 | 4.9e-37 | |
| ZFIN|ZDB-GENE-040426-1308 | 667 | prkg1a "protein kinase, cGMP-d | 0.841 | 0.127 | 0.823 | 5.2e-37 | |
| UNIPROTKB|Q5SQU3 | 659 | PRKG1 "cGMP-dependent protein | 0.841 | 0.128 | 0.811 | 1.8e-36 | |
| UNIPROTKB|P00516 | 671 | PRKG1 "cGMP-dependent protein | 0.841 | 0.126 | 0.811 | 1.9e-36 | |
| UNIPROTKB|Q13976 | 671 | PRKG1 "cGMP-dependent protein | 0.841 | 0.126 | 0.811 | 1.9e-36 | |
| UNIPROTKB|O77676 | 671 | PRKG1 "cGMP-dependent protein | 0.841 | 0.126 | 0.811 | 1.9e-36 |
| FB|FBgn0000721 for "foraging" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 451 (163.8 bits), Expect = 1.7e-41, P = 1.7e-41
Identities = 84/92 (91%), Positives = 87/92 (94%)
Query: 3 FSLNSQGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM 62
F+ Q GRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM
Sbjct: 922 FAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM 981
Query: 63 KTYNIILKGIDAIEFPRNITRNATALIKKLCR 94
+TYNIILKGIDAIEFPRNITRNA+ LIKKLCR
Sbjct: 982 RTYNIILKGIDAIEFPRNITRNASNLIKKLCR 1013
|
|
| UNIPROTKB|J9JHE0 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWY9 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5JP05 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SD02 PRKG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1308 prkg1a "protein kinase, cGMP-dependent, type Ia" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13976 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O77676 PRKG1 "cGMP-dependent protein kinase 1" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 7e-54 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 1e-38 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 7e-35 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 3e-29 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 6e-28 | |
| cd05582 | 318 | cd05582, STKc_RSK_N, N-terminal catalytic domain o | 9e-28 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 2e-27 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 1e-26 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 2e-25 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 2e-25 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 8e-25 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 4e-24 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 1e-23 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 3e-23 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 2e-22 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 3e-22 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 6e-22 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 1e-21 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 2e-21 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 8e-21 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 9e-20 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 2e-19 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 2e-19 | |
| cd05620 | 316 | cd05620, STKc_nPKC_delta, Catalytic domain of the | 3e-19 | |
| cd05615 | 323 | cd05615, STKc_cPKC_alpha, Catalytic domain of the | 4e-19 | |
| cd05575 | 323 | cd05575, STKc_SGK, Catalytic domain of the Protein | 4e-19 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 1e-18 | |
| cd05616 | 323 | cd05616, STKc_cPKC_beta, Catalytic domain of the P | 1e-18 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 2e-18 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 3e-18 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 3e-18 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 5e-18 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 5e-18 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 6e-18 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 6e-18 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 2e-17 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 4e-17 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 5e-17 | |
| cd05588 | 329 | cd05588, STKc_aPKC, Catalytic domain of the Protei | 6e-17 | |
| cd05625 | 382 | cd05625, STKc_LATS1, Catalytic domain of the Prote | 8e-17 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 1e-16 | |
| cd05610 | 669 | cd05610, STKc_MASTL, Catalytic domain of the Prote | 2e-16 | |
| cd05602 | 325 | cd05602, STKc_SGK1, Catalytic domain of the Protei | 3e-16 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 3e-16 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 3e-16 | |
| cd05617 | 327 | cd05617, STKc_aPKC_zeta, Catalytic domain of the P | 4e-16 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 5e-16 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 8e-16 | |
| cd05604 | 325 | cd05604, STKc_SGK3, Catalytic domain of the Protei | 1e-15 | |
| cd05626 | 381 | cd05626, STKc_LATS2, Catalytic domain of the Prote | 1e-15 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 2e-15 | |
| cd05603 | 321 | cd05603, STKc_SGK2, Catalytic domain of the Protei | 2e-15 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 2e-15 | |
| cd05578 | 258 | cd05578, STKc_Yank1, Catalytic domain of the Prote | 2e-15 | |
| cd06917 | 277 | cd06917, STKc_NAK1_like, Catalytic domain of Funga | 3e-15 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 5e-15 | |
| cd05618 | 329 | cd05618, STKc_aPKC_iota, Catalytic domain of the P | 6e-15 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 3e-14 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 4e-14 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 5e-13 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 7e-13 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 1e-12 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 1e-12 | |
| PTZ00283 | 496 | PTZ00283, PTZ00283, serine/threonine protein kinas | 1e-12 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 2e-12 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 3e-12 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 4e-12 | |
| cd05623 | 332 | cd05623, STKc_MRCK_alpha, Catalytic domain of the | 5e-12 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 7e-12 | |
| cd06642 | 277 | cd06642, STKc_STK25-YSK1, Catalytic domain of the | 1e-11 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 1e-11 | |
| PTZ00267 | 478 | PTZ00267, PTZ00267, NIMA-related protein kinase; P | 2e-11 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 3e-11 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 6e-11 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 7e-11 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 8e-11 | |
| cd06640 | 277 | cd06640, STKc_MST4, Catalytic domain of the Protei | 8e-11 | |
| cd07851 | 343 | cd07851, STKc_p38, Catalytic domain of the Serine/ | 8e-11 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 9e-11 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 2e-10 | |
| cd06641 | 277 | cd06641, STKc_MST3, Catalytic domain of the Protei | 2e-10 | |
| cd06655 | 296 | cd06655, STKc_PAK2, Catalytic domain of the Protei | 2e-10 | |
| cd06656 | 297 | cd06656, STKc_PAK3, Catalytic domain of the Protei | 2e-10 | |
| cd06631 | 265 | cd06631, STKc_YSK4, Catalytic domain of the Protei | 3e-10 | |
| cd06654 | 296 | cd06654, STKc_PAK1, Catalytic domain of the Protei | 6e-10 | |
| cd06647 | 293 | cd06647, STKc_PAK_I, Catalytic domain of the Prote | 8e-10 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 8e-10 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 9e-10 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 1e-09 | |
| cd08229 | 267 | cd08229, STKc_Nek7, Catalytic domain of the Protei | 2e-09 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 2e-09 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 3e-09 | |
| cd06637 | 272 | cd06637, STKc_TNIK, Catalytic domain of the Protei | 8e-09 | |
| cd05608 | 280 | cd05608, STKc_GRK1, Catalytic domain of the Protei | 9e-09 | |
| cd05632 | 285 | cd05632, STKc_GRK5, Catalytic domain of the Protei | 1e-08 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 1e-08 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 1e-08 | |
| cd08228 | 267 | cd08228, STKc_Nek6, Catalytic domain of the Protei | 1e-08 | |
| cd06636 | 282 | cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr | 1e-08 | |
| cd06628 | 267 | cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o | 1e-08 | |
| cd06648 | 285 | cd06648, STKc_PAK_II, Catalytic domain of the Prot | 2e-08 | |
| cd07880 | 343 | cd07880, STKc_p38gamma_MAPK12, Catalytic domain of | 3e-08 | |
| cd08222 | 260 | cd08222, STKc_Nek11, Catalytic domain of the Prote | 3e-08 | |
| cd06643 | 282 | cd06643, STKc_SLK, Catalytic domain of the Protein | 4e-08 | |
| cd07879 | 342 | cd07879, STKc_p38delta_MAPK13, Catalytic domain of | 4e-08 | |
| cd05630 | 285 | cd05630, STKc_GRK6, Catalytic domain of the Protei | 4e-08 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 4e-08 | |
| cd06620 | 284 | cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of | 4e-08 | |
| PHA03390 | 267 | PHA03390, pk1, serine/threonine-protein kinase 1; | 6e-08 | |
| cd06657 | 292 | cd06657, STKc_PAK4, Catalytic domain of the Protei | 6e-08 | |
| cd06658 | 292 | cd06658, STKc_PAK5, Catalytic domain of the Protei | 6e-08 | |
| cd05605 | 285 | cd05605, STKc_GRK4_like, Catalytic domain of G pro | 6e-08 | |
| cd08529 | 256 | cd08529, STKc_FA2-like, Catalytic domain of the Pr | 6e-08 | |
| cd08225 | 257 | cd08225, STKc_Nek5, Catalytic domain of the Protei | 7e-08 | |
| cd06659 | 297 | cd06659, STKc_PAK6, Catalytic domain of the Protei | 7e-08 | |
| cd05631 | 285 | cd05631, STKc_GRK4, Catalytic domain of the Protei | 8e-08 | |
| cd07856 | 328 | cd07856, STKc_Sty1_Hog1, Catalytic domain of the S | 1e-07 | |
| cd07876 | 359 | cd07876, STKc_JNK2, Catalytic domain of the Serine | 1e-07 | |
| cd05606 | 278 | cd05606, STKc_beta_ARK, Catalytic domain of the Pr | 1e-07 | |
| cd07877 | 345 | cd07877, STKc_p38alpha_MAPK14, Catalytic domain of | 1e-07 | |
| cd06651 | 266 | cd06651, STKc_MEKK3, Catalytic domain of the Prote | 2e-07 | |
| cd06630 | 268 | cd06630, STKc_MEKK1, Catalytic domain of the Prote | 2e-07 | |
| cd08219 | 255 | cd08219, STKc_Nek3, Catalytic domain of the Protei | 3e-07 | |
| cd08221 | 256 | cd08221, STKc_Nek9, Catalytic domain of the Protei | 3e-07 | |
| cd06607 | 307 | cd06607, STKc_TAO, Catalytic domain of the Protein | 3e-07 | |
| cd06644 | 292 | cd06644, STKc_STK10_LOK, Catalytic domain of the P | 4e-07 | |
| cd07857 | 332 | cd07857, STKc_MPK1, Catalytic domain of the Serine | 4e-07 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 4e-07 | |
| cd06621 | 287 | cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of | 5e-07 | |
| cd05633 | 279 | cd05633, STKc_GRK3, Catalytic domain of the Protei | 7e-07 | |
| cd07849 | 336 | cd07849, STKc_ERK1_2_like, Catalytic domain of Ext | 9e-07 | |
| cd08218 | 256 | cd08218, STKc_Nek1, Catalytic domain of the Protei | 9e-07 | |
| cd06638 | 286 | cd06638, STKc_myosinIIIA, Catalytic domain of the | 9e-07 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 1e-06 | |
| cd05043 | 280 | cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece | 1e-06 | |
| cd06652 | 265 | cd06652, STKc_MEKK2, Catalytic domain of the Prote | 1e-06 | |
| cd06639 | 291 | cd06639, STKc_myosinIIIB, Catalytic domain of the | 2e-06 | |
| cd07875 | 364 | cd07875, STKc_JNK1, Catalytic domain of the Serine | 2e-06 | |
| cd08223 | 257 | cd08223, STKc_Nek4, Catalytic domain of the Protei | 2e-06 | |
| cd06653 | 264 | cd06653, STKc_MEKK3_like_1, Catalytic domain of MA | 2e-06 | |
| cd07878 | 343 | cd07878, STKc_p38beta_MAPK11, Catalytic domain of | 2e-06 | |
| cd07850 | 353 | cd07850, STKc_JNK, Catalytic domain of the Serine/ | 2e-06 | |
| cd06618 | 296 | cd06618, PKc_MKK7, Catalytic domain of the dual-sp | 2e-06 | |
| PTZ00266 | 1021 | PTZ00266, PTZ00266, NIMA-related protein kinase; P | 3e-06 | |
| cd06616 | 288 | cd06616, PKc_MKK4, Catalytic domain of the dual-sp | 4e-06 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 5e-06 | |
| PHA03209 | 357 | PHA03209, PHA03209, serine/threonine kinase US3; P | 5e-06 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 5e-06 | |
| cd06619 | 279 | cd06619, PKc_MKK5, Catalytic domain of the dual-sp | 5e-06 | |
| cd06635 | 317 | cd06635, STKc_TAO1, Catalytic domain of the Protei | 8e-06 | |
| cd06633 | 313 | cd06633, STKc_TAO3, Catalytic domain of the Protei | 8e-06 | |
| cd06634 | 308 | cd06634, STKc_TAO2, Catalytic domain of the Protei | 8e-06 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 8e-06 | |
| cd06617 | 283 | cd06617, PKc_MKK3_6, Catalytic domain of the dual- | 9e-06 | |
| cd05607 | 277 | cd05607, STKc_GRK7, Catalytic domain of the Protei | 1e-05 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 2e-05 | |
| cd08220 | 256 | cd08220, STKc_Nek8, Catalytic domain of the Protei | 2e-05 | |
| cd07854 | 342 | cd07854, STKc_MAPK4_6, Catalytic domain of the Ser | 2e-05 | |
| cd05103 | 343 | cd05103, PTKc_VEGFR2, Catalytic domain of the Prot | 3e-05 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 3e-05 | |
| cd05101 | 304 | cd05101, PTKc_FGFR2, Catalytic domain of the Prote | 4e-05 | |
| PRK13184 | 932 | PRK13184, pknD, serine/threonine-protein kinase; R | 5e-05 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 6e-05 | |
| cd05098 | 307 | cd05098, PTKc_FGFR1, Catalytic domain of the Prote | 6e-05 | |
| cd07874 | 355 | cd07874, STKc_JNK3, Catalytic domain of the Serine | 6e-05 | |
| cd07858 | 337 | cd07858, STKc_TEY_MAPK_plant, Catalytic domain of | 9e-05 | |
| PTZ00284 | 467 | PTZ00284, PTZ00284, protein kinase; Provisional | 1e-04 | |
| cd05576 | 237 | cd05576, STKc_RPK118_like, Catalytic domain of the | 1e-04 | |
| cd06646 | 267 | cd06646, STKc_MAP4K5, Catalytic domain of the Prot | 1e-04 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 1e-04 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 2e-04 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 3e-04 | |
| PTZ00024 | 335 | PTZ00024, PTZ00024, cyclin-dependent protein kinas | 3e-04 | |
| cd05100 | 334 | cd05100, PTKc_FGFR3, Catalytic domain of the Prote | 3e-04 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 3e-04 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 3e-04 | |
| cd06615 | 308 | cd06615, PKc_MEK, Catalytic domain of the dual-spe | 3e-04 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 3e-04 | |
| cd06645 | 267 | cd06645, STKc_MAP4K3, Catalytic domain of the Prot | 4e-04 | |
| cd05054 | 337 | cd05054, PTKc_VEGFR, Catalytic domain of the Prote | 4e-04 | |
| cd07853 | 372 | cd07853, STKc_NLK, Catalytic domain of the Serine/ | 4e-04 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 5e-04 | |
| PHA02988 | 283 | PHA02988, PHA02988, hypothetical protein; Provisio | 6e-04 | |
| cd06649 | 331 | cd06649, PKc_MEK2, Catalytic domain of the dual-sp | 6e-04 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 6e-04 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 7e-04 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 8e-04 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 0.001 | |
| cd07837 | 295 | cd07837, STKc_CdkB_plant, Catalytic domain of the | 0.001 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 0.001 | |
| TIGR03903 | 1266 | TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas | 0.001 | |
| cd06629 | 272 | cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o | 0.001 | |
| cd08528 | 269 | cd08528, STKc_Nek10, Catalytic domain of the Prote | 0.001 | |
| cd07848 | 287 | cd07848, STKc_CDKL5, Catalytic domain of the Serin | 0.001 | |
| PTZ00036 | 440 | PTZ00036, PTZ00036, glycogen synthase kinase; Prov | 0.002 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 0.002 | |
| cd06622 | 286 | cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of | 0.002 | |
| cd05102 | 338 | cd05102, PTKc_VEGFR3, Catalytic domain of the Prot | 0.002 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 0.002 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 0.002 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 0.002 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 0.002 | |
| cd05107 | 401 | cd05107, PTKc_PDGFR_beta, Catalytic domain of the | 0.003 | |
| cd06650 | 333 | cd06650, PKc_MEK1, Catalytic domain of the dual-sp | 0.003 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 0.003 | |
| cd05075 | 272 | cd05075, PTKc_Axl, Catalytic domain of the Protein | 0.003 | |
| cd05114 | 256 | cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro | 0.003 | |
| PHA03212 | 391 | PHA03212, PHA03212, serine/threonine kinase US3; P | 0.004 | |
| cd05074 | 273 | cd05074, PTKc_Tyro3, Catalytic domain of the Prote | 0.004 | |
| smart00750 | 176 | smart00750, KIND, kinase non-catalytic C-lobe doma | 0.004 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 0.004 |
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
Score = 168 bits (427), Expect = 7e-54
Identities = 57/91 (62%), Positives = 69/91 (75%), Gaps = 2/91 (2%)
Query: 8 QGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGS--DPMKTY 65
+ G+KTWTFCGTPEYVAPE+ILN+G+D S DYWSLG+L++ELLTG PPF DPM+ Y
Sbjct: 144 KSGQKTWTFCGTPEYVAPEIILNKGYDFSVDYWSLGILLYELLTGRPPFGEDDEDPMEIY 203
Query: 66 NIILKGIDAIEFPRNITRNATALIKKLCRRL 96
N ILKG +EFP I + A LIK+L RR
Sbjct: 204 NDILKGNGKLEFPNYIDKAAKDLIKQLLRRN 234
|
Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowing autophosphorylation and activation of the kinase. cGKI is a soluble protein expressed in all smooth muscles, platelets, cerebellum, and kidney. It is also expressed at lower concentrations in other tissues. cGKII is a membrane-bound protein that is most abundantly expressed in the intestine. It is also present in the brain nuclei, adrenal cortex, kidney, lung, and prostate. cGKI is involved in the regulation of smooth muscle tone, smooth cell proliferation, and platelet activation. cGKII plays a role in the regulation of secretion, such as renin secretion by the kidney and aldosterone secretion by the adrenal. It also regulates bone growth and the circadian rhythm. Length = 262 |
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein | Back alignment and domain information |
|---|
| >gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| KOG0616|consensus | 355 | 99.9 | ||
| KOG0614|consensus | 732 | 99.89 | ||
| KOG0694|consensus | 694 | 99.89 | ||
| KOG0575|consensus | 592 | 99.88 | ||
| KOG0598|consensus | 357 | 99.87 | ||
| KOG0578|consensus | 550 | 99.87 | ||
| KOG0591|consensus | 375 | 99.85 | ||
| KOG0201|consensus | 467 | 99.84 | ||
| KOG0581|consensus | 364 | 99.84 | ||
| KOG0588|consensus | 786 | 99.83 | ||
| KOG0033|consensus | 355 | 99.82 | ||
| KOG0597|consensus | 808 | 99.82 | ||
| KOG0595|consensus | 429 | 99.82 | ||
| KOG0192|consensus | 362 | 99.8 | ||
| KOG4717|consensus | 864 | 99.8 | ||
| KOG0605|consensus | 550 | 99.79 | ||
| KOG0583|consensus | 370 | 99.79 | ||
| KOG0592|consensus | 604 | 99.79 | ||
| KOG0696|consensus | 683 | 99.79 | ||
| KOG0610|consensus | 459 | 99.78 | ||
| KOG0197|consensus | 468 | 99.78 | ||
| KOG1026|consensus | 774 | 99.76 | ||
| KOG0615|consensus | 475 | 99.76 | ||
| KOG0690|consensus | 516 | 99.75 | ||
| PHA02988 | 283 | hypothetical protein; Provisional | 99.75 | |
| KOG0589|consensus | 426 | 99.75 | ||
| KOG0198|consensus | 313 | 99.75 | ||
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.74 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.72 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.72 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.72 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.72 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.72 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.72 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.71 | |
| KOG0580|consensus | 281 | 99.71 | ||
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.71 | |
| smart00750 | 176 | KIND kinase non-catalytic C-lobe domain. It is an | 99.71 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.71 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.71 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.71 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.7 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.7 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 99.7 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 99.7 | |
| KOG0579|consensus | 1187 | 99.7 | ||
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.7 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.7 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.7 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.7 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.7 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 99.7 | |
| KOG0986|consensus | 591 | 99.7 | ||
| KOG4721|consensus | 904 | 99.7 | ||
| KOG0599|consensus | 411 | 99.69 | ||
| KOG1095|consensus | 1025 | 99.69 | ||
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.69 | |
| KOG0032|consensus | 382 | 99.69 | ||
| KOG0661|consensus | 538 | 99.68 | ||
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.68 | |
| KOG0593|consensus | 396 | 99.68 | ||
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.68 | |
| KOG0983|consensus | 391 | 99.67 | ||
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.67 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 99.67 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.67 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.66 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.66 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.66 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 99.66 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.65 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 99.65 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 99.65 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 99.65 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.65 | |
| KOG0199|consensus | 1039 | 99.64 | ||
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.64 | |
| KOG0596|consensus | 677 | 99.64 | ||
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.64 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.64 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.64 | |
| KOG0604|consensus | 400 | 99.64 | ||
| KOG0577|consensus | 948 | 99.63 | ||
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.63 | |
| KOG0574|consensus | 502 | 99.63 | ||
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.63 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.62 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 99.62 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 99.62 | |
| KOG0660|consensus | 359 | 99.61 | ||
| KOG0200|consensus | 609 | 99.61 | ||
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 99.61 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 99.61 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.61 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.61 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.61 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 99.61 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.61 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 99.61 | |
| KOG4645|consensus | 1509 | 99.61 | ||
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.61 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 99.6 | |
| PTZ00284 | 467 | protein kinase; Provisional | 99.6 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 99.6 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 99.6 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 99.6 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 99.6 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 99.6 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.6 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.6 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 99.6 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 99.6 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.59 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.59 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.59 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 99.59 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.59 | |
| KOG4278|consensus | 1157 | 99.59 | ||
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 99.58 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.58 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 99.58 | |
| KOG4279|consensus | 1226 | 99.58 | ||
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 99.58 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 99.58 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.57 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 99.57 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 99.57 | |
| KOG0603|consensus | 612 | 99.57 | ||
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 99.57 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 99.57 | |
| KOG0585|consensus | 576 | 99.57 | ||
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.57 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 99.57 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 99.57 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 99.57 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 99.57 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 99.56 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.56 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.56 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.56 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.56 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 99.56 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 99.56 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 99.56 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 99.56 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 99.56 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 99.56 | |
| KOG0582|consensus | 516 | 99.55 | ||
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 99.55 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.55 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 99.55 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 99.55 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.55 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 99.55 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 99.55 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 99.55 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 99.55 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 99.55 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.55 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.54 | |
| KOG0193|consensus | 678 | 99.54 | ||
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.54 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 99.54 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 99.54 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 99.54 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 99.54 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 99.54 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 99.54 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.54 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.54 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 99.54 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.54 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 99.54 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 99.53 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 99.53 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.53 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.53 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 99.53 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.53 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 99.53 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 99.53 | |
| KOG0695|consensus | 593 | 99.53 | ||
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 99.53 | |
| KOG1024|consensus | 563 | 99.53 | ||
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.53 | |
| KOG0611|consensus | 668 | 99.53 | ||
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 99.53 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 99.52 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 99.52 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 99.52 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 99.52 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.52 | |
| KOG0196|consensus | 996 | 99.52 | ||
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 99.52 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 99.52 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 99.52 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.52 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.52 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 99.52 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 99.52 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 99.52 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.52 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 99.51 | |
| KOG0600|consensus | 560 | 99.51 | ||
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.51 | |
| KOG0194|consensus | 474 | 99.51 | ||
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 99.51 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 99.51 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 99.51 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 99.51 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 99.51 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 99.5 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 99.5 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 99.5 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 99.5 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.5 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 99.5 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 99.5 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 99.5 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 99.5 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 99.5 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 99.5 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 99.5 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.5 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 99.5 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 99.49 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 99.49 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 99.49 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.49 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 99.49 | |
| KOG0667|consensus | 586 | 99.49 | ||
| KOG0663|consensus | 419 | 99.49 | ||
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 99.49 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 99.49 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 99.49 | |
| KOG4257|consensus | 974 | 99.49 | ||
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 99.49 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 99.49 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 99.49 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 99.48 | |
| KOG0612|consensus | 1317 | 99.48 | ||
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 99.48 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 99.48 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 99.48 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 99.48 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 99.48 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 99.48 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 99.48 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 99.48 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 99.48 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.48 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 99.48 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 99.48 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.48 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 99.47 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 99.47 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 99.47 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 99.47 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 99.47 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.47 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 99.47 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.47 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 99.47 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 99.47 | |
| KOG4236|consensus | 888 | 99.47 | ||
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 99.47 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 99.47 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 99.47 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 99.47 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 99.47 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.47 | |
| KOG0586|consensus | 596 | 99.46 | ||
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 99.46 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 99.46 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 99.46 | |
| KOG0658|consensus | 364 | 99.46 | ||
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 99.46 | |
| KOG0659|consensus | 318 | 99.46 | ||
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 99.46 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 99.46 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.46 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 99.46 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 99.46 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 99.46 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 99.46 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 99.45 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 99.45 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 99.45 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 99.45 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 99.45 | |
| KOG0584|consensus | 632 | 99.45 | ||
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 99.44 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 99.44 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 99.44 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 99.43 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 99.43 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 99.43 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 99.43 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 99.43 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 99.43 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 99.43 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 99.43 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 99.43 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 99.42 | |
| KOG0608|consensus | 1034 | 99.42 | ||
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 99.42 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 99.42 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 99.42 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.42 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 99.41 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.41 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 99.41 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.41 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.41 | |
| KOG0594|consensus | 323 | 99.4 | ||
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.4 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 99.4 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 99.4 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 99.4 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 99.4 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 99.39 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 99.39 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 99.39 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 99.38 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 99.38 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 99.38 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 99.38 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 99.38 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 99.38 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.37 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 99.37 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 99.37 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 99.37 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 99.36 | |
| KOG1006|consensus | 361 | 99.36 | ||
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 99.36 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 99.35 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 99.35 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.35 | |
| KOG0587|consensus | 953 | 99.35 | ||
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 99.35 | |
| KOG0606|consensus | 1205 | 99.35 | ||
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 99.35 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.34 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 99.34 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 99.34 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 99.34 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 99.34 | |
| KOG4250|consensus | 732 | 99.33 | ||
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 99.33 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 99.33 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 99.32 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 99.32 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 99.32 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 99.32 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.31 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 99.31 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 99.31 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 99.3 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 99.3 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.29 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.29 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 99.28 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 99.28 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.28 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 99.28 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 99.27 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 99.26 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 99.26 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 99.26 | |
| KOG1989|consensus | 738 | 99.26 | ||
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 99.26 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 99.24 | |
| KOG0671|consensus | 415 | 99.24 | ||
| KOG1151|consensus | 775 | 99.24 | ||
| KOG0195|consensus | 448 | 99.24 | ||
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 99.23 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.22 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 99.21 | |
| KOG0665|consensus | 369 | 99.18 | ||
| KOG0607|consensus | 463 | 99.18 | ||
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 99.16 | |
| KOG1025|consensus | 1177 | 99.16 | ||
| KOG0984|consensus | 282 | 99.15 | ||
| KOG0603|consensus | 612 | 99.15 | ||
| KOG2345|consensus | 302 | 99.09 | ||
| KOG0669|consensus | 376 | 99.09 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.0 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 98.97 | |
| KOG1094|consensus | 807 | 98.97 | ||
| KOG0662|consensus | 292 | 98.96 | ||
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 98.92 | |
| KOG1033|consensus | 516 | 98.91 | ||
| KOG1290|consensus | 590 | 98.91 | ||
| KOG0576|consensus | 829 | 98.89 | ||
| KOG0670|consensus | 752 | 98.87 | ||
| KOG0668|consensus | 338 | 98.86 | ||
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 98.83 | |
| KOG1027|consensus | 903 | 98.82 | ||
| KOG1187|consensus | 361 | 98.82 | ||
| PF14531 | 288 | Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ | 98.82 | |
| KOG1035|consensus | 1351 | 98.8 | ||
| KOG0664|consensus | 449 | 98.75 | ||
| KOG0666|consensus | 438 | 98.63 | ||
| KOG3653|consensus | 534 | 98.63 | ||
| KOG2052|consensus | 513 | 98.6 | ||
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 98.39 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 98.1 | |
| KOG4158|consensus | 598 | 98.06 | ||
| KOG0606|consensus | 1205 | 98.04 | ||
| KOG1164|consensus | 322 | 97.94 | ||
| KOG1023|consensus | 484 | 97.92 | ||
| KOG1152|consensus | 772 | 97.9 | ||
| KOG0590|consensus | 601 | 97.88 | ||
| KOG1345|consensus | 378 | 97.68 | ||
| KOG1167|consensus | 418 | 97.66 | ||
| KOG1240|consensus | 1431 | 97.63 | ||
| KOG1165|consensus | 449 | 97.24 | ||
| KOG0590|consensus | 601 | 97.07 | ||
| KOG1163|consensus | 341 | 95.61 | ||
| KOG2137|consensus | 700 | 91.52 | ||
| COG4248 | 637 | Uncharacterized protein with protein kinase and he | 89.08 |
| >KOG0616|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=2.8e-23 Score=124.91 Aligned_cols=96 Identities=42% Similarity=0.881 Sum_probs=88.7
Q ss_pred CeeeeecCCCcceeeeccccccccchhhccCCCCchhHHHHHHHHHHHHHhCCCCCCCCChhhHHHHHHhCCCCcCCCCc
Q psy17576 1 MIFSLNSQGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRN 80 (101)
Q Consensus 1 ~~~~~~~~~~~~~~~~~gt~~~~~pe~~~~~~~~~~~d~~s~g~~l~~~~~~~~p~~~~~~~~~~~~i~~~~~~~~~p~~ 80 (101)
|||++.+.+. +.++||||-|++||++..+.|+..+|.|++|+++|||+.|..||...++..++++|..+ ...+|+.
T Consensus 188 FGFAK~v~~r--T~TlCGTPeYLAPEii~sk~ynkavDWWalGVLIYEMlaG~pPF~~~~~~~iY~KI~~~--~v~fP~~ 263 (355)
T KOG0616|consen 188 FGFAKRVSGR--TWTLCGTPEYLAPEIIQSKGYNKAVDWWALGVLIYEMLAGYPPFYDDNPIQIYEKILEG--KVKFPSY 263 (355)
T ss_pred ccceEEecCc--EEEecCCccccChHHhhcCCCCcchhHHHHHHHHHHHHcCCCCCcCCChHHHHHHHHhC--cccCCcc
Confidence 8999999655 88999999999999999999999999999999999999999999999999999999997 4899999
Q ss_pred cCHHHHHHHHHHHHHhccCC
Q psy17576 81 ITRNATALIKKLCRRLTLNT 100 (101)
Q Consensus 81 ~~~~~~~li~~~~~~~~~~~ 100 (101)
+++++++|++++++.+.-.|
T Consensus 264 fs~~~kdLl~~LL~vD~t~R 283 (355)
T KOG0616|consen 264 FSSDAKDLLKKLLQVDLTKR 283 (355)
T ss_pred cCHHHHHHHHHHHhhhhHhh
Confidence 99999999999998765443
|
|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >KOG0578|consensus | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >KOG0033|consensus | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >KOG4717|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0589|consensus | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >smart00750 KIND kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0579|consensus | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >KOG0599|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >KOG0661|consensus | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >KOG0983|consensus | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG0596|consensus | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >KOG0577|consensus | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >KOG0574|consensus | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0660|consensus | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4645|consensus | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG4279|consensus | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >KOG1024|consensus | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >KOG0611|consensus | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >KOG0667|consensus | Back alignment and domain information |
|---|
| >KOG0663|consensus | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >KOG0586|consensus | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >KOG0658|consensus | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >KOG0659|consensus | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >KOG0584|consensus | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >KOG0594|consensus | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >KOG1006|consensus | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >KOG0587|consensus | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >KOG4250|consensus | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >KOG1989|consensus | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >KOG0671|consensus | Back alignment and domain information |
|---|
| >KOG1151|consensus | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >KOG0665|consensus | Back alignment and domain information |
|---|
| >KOG0607|consensus | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >KOG0984|consensus | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >KOG2345|consensus | Back alignment and domain information |
|---|
| >KOG0669|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG1094|consensus | Back alignment and domain information |
|---|
| >KOG0662|consensus | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1033|consensus | Back alignment and domain information |
|---|
| >KOG1290|consensus | Back alignment and domain information |
|---|
| >KOG0576|consensus | Back alignment and domain information |
|---|
| >KOG0670|consensus | Back alignment and domain information |
|---|
| >KOG0668|consensus | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG1027|consensus | Back alignment and domain information |
|---|
| >KOG1187|consensus | Back alignment and domain information |
|---|
| >PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A | Back alignment and domain information |
|---|
| >KOG1035|consensus | Back alignment and domain information |
|---|
| >KOG0664|consensus | Back alignment and domain information |
|---|
| >KOG0666|consensus | Back alignment and domain information |
|---|
| >KOG3653|consensus | Back alignment and domain information |
|---|
| >KOG2052|consensus | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG4158|consensus | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >KOG1164|consensus | Back alignment and domain information |
|---|
| >KOG1023|consensus | Back alignment and domain information |
|---|
| >KOG1152|consensus | Back alignment and domain information |
|---|
| >KOG0590|consensus | Back alignment and domain information |
|---|
| >KOG1345|consensus | Back alignment and domain information |
|---|
| >KOG1167|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG1165|consensus | Back alignment and domain information |
|---|
| >KOG0590|consensus | Back alignment and domain information |
|---|
| >KOG1163|consensus | Back alignment and domain information |
|---|
| >KOG2137|consensus | Back alignment and domain information |
|---|
| >COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 101 | ||||
| 4el9_A | 305 | Structure Of N-Terminal Kinase Domain Of Rsk2 With | 1e-19 | ||
| 3ubd_A | 304 | Structure Of N-Terminal Domain Of Rsk2 Kinase In Co | 1e-19 | ||
| 3g51_A | 325 | Structural Diversity Of The Active Conformation Of | 1e-19 | ||
| 2uzt_A | 336 | Pka Structures Of Akt, Indazole-Pyridine Inhibitors | 8e-19 | ||
| 2f7e_E | 351 | Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu | 8e-19 | ||
| 2z7q_A | 321 | Crystal Structure Of The N-Terminal Kinase Domain O | 9e-19 | ||
| 3a60_A | 327 | Crystal Structure Of Unphosphorylated P70s6k1 (Form | 9e-19 | ||
| 4dfy_A | 371 | Crystal Structure Of R194a Mutant Of Camp-Dependent | 2e-18 | ||
| 1xh9_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 2e-18 | ||
| 1smh_A | 350 | Protein Kinase A Variant Complex With Completely Or | 2e-18 | ||
| 1jbp_E | 350 | Crystal Structure Of The Catalytic Subunit Of Camp- | 2e-18 | ||
| 3a62_A | 327 | Crystal Structure Of Phosphorylated P70s6k1 Length | 3e-18 | ||
| 4dg3_E | 371 | Crystal Structure Of R336a Mutant Of Camp-dependent | 4e-18 | ||
| 2erz_E | 351 | Crystal Structure Of C-amp Dependent Kinase (pka) B | 4e-18 | ||
| 1fmo_E | 350 | Crystal Structure Of A Polyhistidine-Tagged Recombi | 4e-18 | ||
| 4dfx_E | 350 | Crystal Structure Of Myristoylated K7c Catalytic Su | 4e-18 | ||
| 3qal_E | 350 | Crystal Structure Of Arg280ala Mutant Of Catalytic | 4e-18 | ||
| 2qur_A | 350 | Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe | 4e-18 | ||
| 2qcs_A | 350 | A Complex Structure Between The Catalytic And Regul | 4e-18 | ||
| 2gu8_A | 337 | Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel | 4e-18 | ||
| 2jdt_A | 351 | Structure Of Pka-Pkb Chimera Complexed With Isoquin | 4e-18 | ||
| 1bkx_A | 350 | A Binary Complex Of The Catalytic Subunit Of Camp-D | 4e-18 | ||
| 2c1a_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 4e-18 | ||
| 1xh7_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 4e-18 | ||
| 1svh_A | 350 | Crystal Structure Of Protein Kinase A In Complex Wi | 4e-18 | ||
| 1szm_A | 350 | Dual Binding Mode Of Bisindolylmaleimide 2 To Prote | 4e-18 | ||
| 1q8w_A | 350 | The Catalytic Subunit Of Camp-Dependent Protein Kin | 4e-18 | ||
| 1q61_A | 350 | Pka Triple Mutant Model Of Pkb Length = 350 | 4e-18 | ||
| 1q24_A | 350 | Pka Double Mutant Model Of Pkb In Complex With Mgat | 4e-18 | ||
| 1l3r_E | 350 | Crystal Structure Of A Transition State Mimic Of Th | 4e-18 | ||
| 4ae9_A | 343 | Structure And Function Of The Human Sperm-specific | 4e-18 | ||
| 4ae6_A | 343 | Structure And Function Of The Human Sperm-specific | 4e-18 | ||
| 3nx8_A | 351 | Human Camp Dependent Protein Kinase In Complex With | 4e-18 | ||
| 1ctp_E | 350 | Structure Of The Mammalian Catalytic Subunit Of Cam | 4e-18 | ||
| 1cdk_A | 350 | Camp-Dependent Protein Kinase Catalytic Subunit (E. | 4e-18 | ||
| 3pvb_A | 345 | Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca | 4e-18 | ||
| 3l9m_A | 351 | Crystal Structure Of Pkab3 (Pka Triple Mutant V123a | 4e-18 | ||
| 3agm_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 4e-18 | ||
| 3agl_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 4e-18 | ||
| 3mvj_A | 371 | Human Cyclic Amp-Dependent Protein Kinase Pka Inhib | 4e-18 | ||
| 1apm_E | 350 | 2.0 Angstrom Refined Crystal Structure Of The Catal | 4e-18 | ||
| 3dnd_A | 350 | Camp-Dependent Protein Kinase Pka Catalytic Subunit | 4e-18 | ||
| 2vo0_A | 351 | Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 | 4e-18 | ||
| 1cmk_E | 350 | Crystal Structures Of The Myristylated Catalytic Su | 4e-18 | ||
| 2uvy_A | 351 | Structure Of Pka-pkb Chimera Complexed With Methyl- | 4e-18 | ||
| 2jds_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 4e-18 | ||
| 2gnf_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 4e-18 | ||
| 2gnj_A | 350 | Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 | 4e-18 | ||
| 1ydt_E | 350 | Structure Of Camp-Dependent Protein Kinase, Alpha-C | 4e-18 | ||
| 1stc_E | 350 | Camp-Dependent Protein Kinase, Alpha-Catalytic Subu | 4e-18 | ||
| 3ama_A | 351 | Protein Kinase A Sixfold Mutant Model Of Aurora B W | 4e-18 | ||
| 2gng_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 4e-18 | ||
| 3o7l_B | 350 | Crystal Structure Of Phospholamban (1-19):pka C-Sub | 8e-18 | ||
| 1syk_A | 350 | Crystal Structure Of E230q Mutant Of Camp-Dependent | 9e-18 | ||
| 3qam_E | 350 | Crystal Structure Of Glu208ala Mutant Of Catalytic | 2e-17 | ||
| 1rdq_E | 350 | Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of | 4e-17 | ||
| 3fhi_A | 350 | Crystal Structure Of A Complex Between The Catalyti | 5e-17 | ||
| 1j3h_A | 350 | Crystal Structure Of Apoenzyme Camp-Dependent Prote | 9e-17 | ||
| 1xjd_A | 345 | Crystal Structure Of Pkc-Theta Complexed With Staur | 3e-15 | ||
| 2jed_A | 352 | The Crystal Structure Of The Kinase Domain Of The P | 3e-15 | ||
| 3d5u_A | 317 | Crystal Structure Of A Wildtype Polo-Like Kinase 1 | 4e-15 | ||
| 1mrv_A | 339 | Crystal Structure Of An Inactive Akt2 Kinase Domain | 5e-15 | ||
| 1gzn_A | 335 | Structure Of Pkb Kinase Domain Length = 335 | 5e-15 | ||
| 1gzk_A | 315 | Molecular Mechanism For The Regulation Of Protein K | 5e-15 | ||
| 4ejn_A | 446 | Crystal Structure Of Autoinhibited Form Of Akt1 In | 5e-15 | ||
| 3o96_A | 446 | Crystal Structure Of Human Akt1 With An Allosteric | 5e-15 | ||
| 3iw4_A | 360 | Crystal Structure Of Pkc Alpha In Complex With Nvp- | 6e-15 | ||
| 1fot_A | 318 | Structure Of The Unliganded Camp-Dependent Protein | 1e-14 | ||
| 3d5w_A | 317 | Crystal Structure Of A Phosphorylated Polo-Like Kin | 2e-14 | ||
| 3d5v_A | 317 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 2e-14 | ||
| 2yac_A | 311 | Crystal Structure Of Polo-Like Kinase 1 In Complex | 2e-14 | ||
| 3kb7_A | 311 | Crystal Structure Of Polo-Like Kinase 1 In Complex | 2e-14 | ||
| 4gv1_A | 340 | Pkb Alpha In Complex With Azd5363 Length = 340 | 2e-14 | ||
| 1o6k_A | 336 | Structure Of Activated Form Of Pkb Kinase Domain S4 | 2e-14 | ||
| 3ocb_A | 341 | Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor | 2e-14 | ||
| 3e87_A | 335 | Crystal Structures Of The Kinase Domain Of Akt2 In | 2e-14 | ||
| 3cqu_A | 342 | Crystal Structure Of Akt-1 Complexed With Substrate | 2e-14 | ||
| 2v5q_A | 315 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 2e-14 | ||
| 2jdo_A | 342 | Structure Of Pkb-Beta (Akt2) Complexed With Isoquin | 2e-14 | ||
| 1o6l_A | 337 | Crystal Structure Of An Activated Akt/protein Kinas | 2e-14 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 2e-14 | ||
| 2i0e_A | 353 | Structure Of Catalytic Domain Of Human Protein Kina | 2e-14 | ||
| 2r5t_A | 373 | Crystal Structure Of Inactive Serum And Glucocortic | 3e-14 | ||
| 3db6_A | 301 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 5e-14 | ||
| 3thb_A | 333 | Structure Of Plk1 Kinase Domain In Complex With A B | 7e-14 | ||
| 2ou7_A | 335 | Structure Of The Catalytic Domain Of Human Polo-Lik | 8e-14 | ||
| 2rku_A | 294 | Structure Of Plk1 In Complex With Bi2536 Length = 2 | 9e-14 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 1e-13 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 3e-13 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 3e-13 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 3e-13 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 3e-13 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 3e-13 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 3e-13 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 3e-13 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 4e-13 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 4e-13 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 4e-13 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 4e-13 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 4e-13 | ||
| 4dc2_A | 396 | Structure Of Pkc In Complex With A Substrate Peptid | 4e-13 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 6e-13 | ||
| 1vzo_A | 355 | The Structure Of The N-Terminal Kinase Domain Of Ms | 8e-13 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 1e-12 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 1e-12 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 1e-12 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 1e-12 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 1e-12 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 1e-12 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 1e-12 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 1e-12 | ||
| 3zh8_A | 349 | A Novel Small Molecule Apkc Inhibitor Length = 349 | 2e-12 | ||
| 3a8w_A | 345 | Crystal Structure Of Pkciota Kinase Domain Length = | 2e-12 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 2e-12 | ||
| 1zrz_A | 364 | Crystal Structure Of The Catalytic Domain Of Atypic | 2e-12 | ||
| 3txo_A | 353 | Pkc Eta Kinase In Complex With A Naphthyridine Leng | 2e-12 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 3e-12 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 3e-12 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 3e-12 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 3e-12 | ||
| 3cok_A | 278 | Crystal Structure Of Plk4 Kinase Length = 278 | 4e-12 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 4e-12 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 5e-12 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 5e-12 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 5e-12 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 1e-11 | ||
| 2esm_A | 415 | Crystal Structure Of Rock 1 Bound To Fasudil Length | 5e-11 | ||
| 3v8s_A | 410 | Human Rho-Associated Protein Kinase 1 (Rock 1) In C | 5e-11 | ||
| 2v55_A | 406 | Mechanism Of Multi-site Phosphorylation From A Rock | 5e-11 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 9e-11 | ||
| 3bhh_A | 295 | Crystal Structure Of Human Calcium/calmodulin-depen | 1e-10 | ||
| 4fg7_A | 293 | Crystal Structure Of Human Calcium/calmodulin-depen | 2e-10 | ||
| 2wel_A | 327 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 2e-10 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 3e-10 | ||
| 4fg9_A | 320 | Crystal Structure Of Human Calcium/calmodulin-depen | 4e-10 | ||
| 4fg8_A | 315 | Crystal Structure Of Human Calcium/calmodulin-depen | 4e-10 | ||
| 1a06_A | 332 | Calmodulin-Dependent Protein Kinase From Rat Length | 4e-10 | ||
| 2jc6_A | 334 | Crystal Structure Of Human Calmodulin-Dependent Pro | 4e-10 | ||
| 4aw2_A | 437 | Crystal Structure Of Cdc42 Binding Protein Kinase A | 4e-10 | ||
| 2v7o_A | 336 | Crystal Structure Of Human Calcium-Calmodulin-Depen | 4e-10 | ||
| 3qfv_A | 415 | Mrck Beta In Complex With Tpca-1 Length = 415 | 4e-10 | ||
| 3tku_A | 433 | Mrck Beta In Complex With Fasudil Length = 433 | 4e-10 | ||
| 2vn9_A | 301 | Crystal Structure Of Human Calcium Calmodulin Depen | 4e-10 | ||
| 2y0a_A | 326 | Structure Of Dapk1 Construct Residues 1-304 Length | 7e-10 | ||
| 2xzs_A | 312 | Death Associated Protein Kinase 1 Residues 1-312 Le | 7e-10 | ||
| 2x0g_A | 334 | X-ray Structure Of A Dap-kinase Calmodulin Complex | 7e-10 | ||
| 3soa_A | 444 | Full-Length Human Camkii Length = 444 | 8e-10 | ||
| 2vz6_A | 313 | Structure Of Human Calcium Calmodulin Dependent Pro | 8e-10 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 1e-09 | ||
| 2yak_A | 285 | Structure Of Death-Associated Protein Kinase 1 (Dap | 1e-09 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 1e-09 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 1e-09 | ||
| 2w4k_A | 302 | X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | 1e-09 | ||
| 2w4j_A | 277 | X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | 1e-09 | ||
| 1ig1_A | 294 | 1.8a X-Ray Structure Of Ternary Complex Of A Cataly | 1e-09 | ||
| 3gu4_A | 295 | Crystal Structure Of Dapkq23v-Amppnp Length = 295 | 1e-09 | ||
| 3f5u_A | 295 | Crystal Structure Of The Death Associated Protein K | 1e-09 | ||
| 1wvw_A | 278 | Crystal Structures Of Kinase Domain Of Dap Kinase I | 1e-09 | ||
| 1p4f_A | 293 | Death Associated Protein Kinase Catalytic Domain Wi | 1e-09 | ||
| 3dfc_B | 295 | Crystal Structure Of A Glycine-Rich Loop Mutant Of | 1e-09 | ||
| 3gu8_A | 295 | Crystal Structure Of Dapkl93g With N6-Cyclopentylad | 1e-09 | ||
| 3ma6_A | 298 | Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr | 2e-09 | ||
| 2y7j_A | 365 | Structure Of Human Phosphorylase Kinase, Gamma 2 Le | 2e-09 | ||
| 2jam_A | 304 | Crystal Structure Of Human Calmodulin-Dependent Pro | 2e-09 | ||
| 3iec_A | 319 | Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K | 2e-09 | ||
| 2r0i_A | 327 | Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len | 2e-09 | ||
| 1zmv_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 2e-09 | ||
| 1zmu_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 2e-09 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 2e-09 | ||
| 3lij_A | 494 | Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) | 2e-09 | ||
| 3ckw_A | 304 | Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 | 3e-09 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 3e-09 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 3e-09 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 3e-09 | ||
| 2hak_A | 328 | Catalytic And Ubiqutin-Associated Domains Of Mark1P | 3e-09 | ||
| 2j90_A | 304 | Crystal Structure Of Human Zip Kinase In Complex Wi | 3e-09 | ||
| 2xuu_A | 334 | Crystal Structure Of A Dap-Kinase 1 Mutant Length = | 4e-09 | ||
| 1yrp_A | 278 | Catalytic Domain Of Human Zip Kinase Phosphorylated | 4e-09 | ||
| 3dfa_A | 286 | Crystal Structure Of Kinase Domain Of Calcium-depen | 4e-09 | ||
| 2wei_A | 287 | Crystal Structure Of The Kinase Domain Of Cryptospo | 4e-09 | ||
| 3bhy_A | 283 | Crystal Structure Of Human Death Associated Protein | 4e-09 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 5e-09 | ||
| 2qnj_A | 328 | Kinase And Ubiquitin-Associated Domains Of Mark3PAR | 5e-09 | ||
| 1ql6_A | 298 | The Catalytic Mechanism Of Phosphorylase Kinase Pro | 5e-09 | ||
| 3zhp_C | 294 | Human Mst3 (stk24) In Complex With Mo25beta Length | 5e-09 | ||
| 3q4z_A | 306 | Structure Of Unphosphorylated Pak1 Kinase Domain Le | 6e-09 | ||
| 3pwy_A | 311 | Crystal Structure Of An Extender (Spd28345)-Modifie | 6e-09 | ||
| 2phk_A | 277 | The Crystal Structure Of A Phosphorylase Kinase Pep | 8e-09 | ||
| 1phk_A | 298 | Two Structures Of The Catalytic Domain Of Phosphory | 8e-09 | ||
| 3ggf_A | 301 | Crystal Structure Of Human SerineTHREONINE-Protein | 8e-09 | ||
| 3ckx_A | 304 | Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 | 9e-09 | ||
| 2wzj_A | 327 | Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 | 1e-08 | ||
| 2ycr_A | 323 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 1e-08 | ||
| 2ycf_A | 322 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 1e-08 | ||
| 2xk9_A | 322 | Structural Analysis Of Checkpoint Kinase 2 (Chk2) I | 1e-08 | ||
| 3i6w_A | 443 | Structure And Activation Mechanism Of The Chk2 Dna- | 1e-08 | ||
| 3i6u_A | 419 | Structure And Activation Mechanism Of The Chk2 Dna- | 1e-08 | ||
| 2w0j_A | 323 | Crystal Structure Of Chk2 In Complex With Nsc 10955 | 1e-08 | ||
| 2cn5_A | 329 | Crystal Structure Of Human Chk2 In Complex With Adp | 1e-08 | ||
| 2onl_C | 406 | Crystal Structure Of The P38a-Mapkap Kinase 2 Heter | 1e-08 | ||
| 2oza_A | 356 | Structure Of P38alpha Complex Length = 356 | 1e-08 | ||
| 1kwp_A | 400 | Crystal Structure Of Mapkap2 Length = 400 | 1e-08 | ||
| 2p3g_X | 327 | Crystal Structure Of A Pyrrolopyridine Inhibitor Bo | 1e-08 | ||
| 1zmw_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 1e-08 | ||
| 3r1n_A | 317 | Mk3 Kinase Bound To Compound 5b Length = 317 | 1e-08 | ||
| 3fhr_A | 336 | High Resolution Crystal Structure Of Mitogen-Activa | 1e-08 | ||
| 2pzy_A | 324 | Structure Of Mk2 Complexed With Compound 76 Length | 1e-08 | ||
| 3fpm_A | 325 | Crystal Structure Of A Squarate Inhibitor Bound To | 1e-08 | ||
| 2jbo_A | 326 | Protein Kinase Mk2 In Complex With An Inhibitor (Cr | 1e-08 | ||
| 3a7f_A | 303 | Human Mst3 Kinase Length = 303 | 1e-08 | ||
| 3ka0_A | 320 | Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 | 1e-08 | ||
| 3nax_A | 311 | Pdk1 In Complex With Inhibitor Mp7 Length = 311 | 2e-08 | ||
| 2r7b_A | 312 | Crystal Structure Of The Phosphoinositide-Dependent | 2e-08 | ||
| 1y8g_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 2e-08 | ||
| 2vwi_A | 303 | Structure Of The Osr1 Kinase, A Hypertension Drug T | 2e-08 | ||
| 3q52_A | 306 | Structure Of Phosphorylated Pak1 Kinase Domain Leng | 2e-08 | ||
| 3dak_A | 290 | Crystal Structure Of Domain-Swapped Osr1 Kinase Dom | 2e-08 | ||
| 1f3m_C | 297 | Crystal Structure Of Human SerineTHREONINE KINASE P | 2e-08 | ||
| 2qr8_A | 342 | 2.0a X-ray Structure Of C-terminal Kinase Domain Of | 2e-08 | ||
| 2biy_A | 310 | Structure Of Pdk1-S241a Mutant Kinase Domain Length | 2e-08 | ||
| 1z5m_A | 286 | Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr | 2e-08 | ||
| 2xik_A | 294 | Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K | 2e-08 | ||
| 3nun_A | 292 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea | 2e-08 | ||
| 3nus_A | 286 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra | 2e-08 | ||
| 1uu9_A | 286 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 3e-08 | ||
| 1h1w_A | 289 | High Resolution Crystal Structure Of The Human Pdk1 | 3e-08 | ||
| 2xck_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 3e-08 | ||
| 3fe3_A | 328 | Crystal Structure Of The Kinase Mark3PAR-1: T211a-S | 3e-08 | ||
| 1uu3_A | 310 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 3e-08 | ||
| 3rwp_A | 311 | Discovery Of A Novel, Potent And Selective Inhibito | 3e-08 | ||
| 3sc1_A | 311 | Novel Isoquinolone Pdk1 Inhibitors Discovered Throu | 3e-08 | ||
| 2xch_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 3e-08 | ||
| 3iop_A | 312 | Pdk-1 In Complex With The Inhibitor Compound-8i Len | 3e-08 | ||
| 3h9o_A | 311 | Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) | 3e-08 | ||
| 3orx_A | 316 | Pdk1 Mutant Bound To Allosteric Disulfide Fragment | 3e-08 | ||
| 3nay_A | 311 | Pdk1 In Complex With Inhibitor Mp6 Length = 311 | 3e-08 | ||
| 3r2b_A | 318 | Mk2 Kinase Bound To Compound 5b Length = 318 | 3e-08 | ||
| 3r2y_A | 319 | Mk2 Kinase Bound To Compound 1 Length = 319 | 3e-08 | ||
| 3gok_A | 334 | Binding Site Mapping Of Protein Ligands Length = 33 | 3e-08 | ||
| 4a07_A | 311 | Human Pdk1 Kinase Domain In Complex With Allosteric | 4e-08 | ||
| 3lm0_A | 327 | Crystal Structure Of Human SerineTHREONINE KINASE 1 | 4e-08 | ||
| 1wmk_A | 321 | Human Death-Associated Kinase Drp-1, Mutant S308d D | 4e-08 | ||
| 2ya9_A | 361 | Crystal Structure Of The Autoinhibited Form Of Mous | 4e-08 | ||
| 2a27_A | 321 | Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal | 4e-08 | ||
| 2bdw_A | 362 | Crystal Structure Of The Auto-Inhibited Kinase Doma | 4e-08 | ||
| 3qc4_A | 314 | Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = | 6e-08 | ||
| 2qr7_A | 342 | 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of | 6e-08 | ||
| 2x4f_A | 373 | The Crystal Structure Of The Human Myosin Light Cha | 6e-08 | ||
| 1nxk_A | 400 | Crystal Structure Of Staurosporine Bound To Map Kap | 7e-08 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 7e-08 | ||
| 3hrc_A | 311 | Crystal Structure Of A Mutant Of Human Pdk1 Kinase | 7e-08 | ||
| 1yhv_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Two Po | 7e-08 | ||
| 3fxz_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Ruthen | 7e-08 | ||
| 2a2a_A | 321 | High-resolution Crystallographic Analysis Of The Au | 8e-08 | ||
| 1z9x_A | 321 | Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal | 8e-08 | ||
| 3kn5_A | 325 | Crystal Structure Of The C-Terminal Kinase Domain O | 9e-08 | ||
| 3kk9_A | 282 | Camkii Substrate Complex B Length = 282 | 1e-07 | ||
| 3kl8_A | 269 | Camkiintide Inhibitor Complex Length = 269 | 1e-07 | ||
| 3kk8_A | 284 | Camkii Substrate Complex A Length = 284 | 1e-07 | ||
| 3com_A | 314 | Crystal Structure Of Mst1 Kinase Length = 314 | 1e-07 | ||
| 2clq_A | 295 | Structure Of Mitogen-Activated Protein Kinase Kinas | 1e-07 | ||
| 2wqm_A | 310 | Structure Of Apo Human Nek7 Length = 310 | 1e-07 | ||
| 1o6y_A | 299 | Catalytic Domain Of Pknb Kinase From Mycobacterium | 1e-07 | ||
| 2wnt_A | 330 | Crystal Structure Of The Human Ribosomal Protein S6 | 2e-07 | ||
| 1zws_A | 288 | Crystal Structure Of The Catalytic Domain Of Human | 2e-07 | ||
| 3llt_A | 360 | Crystal Structure Of Pf14_0431, Kinase Domain Lengt | 2e-07 | ||
| 3vw6_A | 269 | Crystal Structure Of Human Apoptosis Signal-Regulat | 2e-07 | ||
| 3rny_A | 346 | Crystal Structure Of Human Rsk1 C-Terminal Kinase D | 2e-07 | ||
| 2x7f_A | 326 | Crystal Structure Of The Kinase Domain Of Human Tra | 2e-07 | ||
| 3t8o_A | 543 | Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu | 2e-07 | ||
| 3qc9_A | 543 | Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 | 2e-07 | ||
| 3c4x_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 2e-07 | ||
| 3c4w_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 2e-07 | ||
| 3orm_A | 311 | Mycobacterium Tuberculosis Pknb Kinase Domain D76a | 2e-07 | ||
| 3ori_A | 311 | Mycobacterium Tuberculosis Pknb Kinase Domain L33d | 2e-07 | ||
| 3f69_A | 311 | Crystal Structure Of The Mycobacterium Tuberculosis | 2e-07 | ||
| 1mru_A | 311 | Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob | 2e-07 | ||
| 3rzf_A | 677 | Crystal Structure Of Inhibitor Of Kappab Kinase Bet | 3e-07 | ||
| 3qa8_A | 676 | Crystal Structure Of Inhibitor Of Kappa B Kinase Be | 3e-07 | ||
| 3f61_A | 311 | Crystal Structure Of M. Tuberculosis Pknb Leu33aspV | 3e-07 | ||
| 3anq_A | 368 | Human Dyrk1aINHIBITOR COMPLEX Length = 368 | 4e-07 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 4e-07 | ||
| 2ac3_A | 316 | Structure Of Human Mnk2 Kinase Domain Length = 316 | 5e-07 | ||
| 2ac5_A | 316 | Structure Of Human Mnk2 Kinase Domain Mutant D228g | 5e-07 | ||
| 4aze_A | 382 | Human Dyrk1a In Complex With Leucettine L41 Length | 5e-07 | ||
| 2vx3_A | 382 | Crystal Structure Of The Human Dual Specificity Tyr | 5e-07 | ||
| 3zgw_A | 347 | Crystal Structure Of Maternal Embryonic Leucine Zip | 6e-07 | ||
| 4fif_A | 346 | Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid | 8e-07 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 8e-07 | ||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 9e-07 | ||
| 4fie_A | 423 | Full-Length Human Pak4 Length = 423 | 9e-07 | ||
| 2j51_A | 325 | Crystal Structure Of Human Ste20-Like Kinase Bound | 1e-06 | ||
| 2jfm_A | 325 | Crystal Structure Of Human Ste20-Like Kinase (Unlig | 1e-06 | ||
| 2f57_A | 317 | Crystal Structure Of The Human P21-activated Kinase | 1e-06 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 1e-06 | ||
| 2hw6_A | 307 | Crystal Structure Of Mnk1 Catalytic Domain Length = | 1e-06 | ||
| 1yw2_A | 360 | Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | 1e-06 | ||
| 2ghl_A | 348 | Mutant Mus Musculus P38 Kinase Domain In Complex Wi | 1e-06 | ||
| 3uc3_A | 361 | The Crystal Structure Of Snf1-Related Kinase 2.3 Le | 1e-06 | ||
| 1ywr_A | 360 | Crystal Structure Analysis Of Inactive P38 Kinase D | 1e-06 | ||
| 2uv2_A | 287 | Crystal Structure Of Human Ste20-Like Kinase Bound | 1e-06 | ||
| 2c30_A | 321 | Crystal Structure Of The Human P21-Activated Kinase | 2e-06 | ||
| 3nyn_A | 576 | Crystal Structure Of G Protein-Coupled Receptor Kin | 2e-06 | ||
| 2acx_A | 576 | Crystal Structure Of G Protein Coupled Receptor Kin | 2e-06 | ||
| 2jfl_A | 325 | Crystal Structure Of Human Ste20-Like Kinase ( Diph | 2e-06 | ||
| 2w5a_A | 279 | Human Nek2 Kinase Adp-Bound Length = 279 | 2e-06 | ||
| 4fr4_A | 384 | Crystal Structure Of Human SerineTHREONINE-Protein | 2e-06 | ||
| 2q0n_A | 301 | Structure Of Human P21 Activating Kinase 4 (Pak4) I | 2e-06 | ||
| 2cdz_A | 303 | Crystal Structure Of The Human P21-Activated Kinase | 2e-06 | ||
| 3tac_A | 361 | Crystal Structure Of The Liprin-AlphaCASK COMPLEX L | 2e-06 | ||
| 3mfr_A | 351 | Cask-4m Cam Kinase Domain, Native Length = 351 | 2e-06 | ||
| 3c0g_A | 351 | Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len | 2e-06 | ||
| 2bva_A | 292 | Crystal Structure Of The Human P21-Activated Kinase | 2e-06 | ||
| 2x4z_A | 296 | Crystal Structure Of The Human P21-Activated Kinase | 2e-06 | ||
| 4e5a_X | 360 | The W197a Mutant Of P38a Map Kinase Length = 360 | 2e-06 | ||
| 2qg5_A | 294 | Cryptosporidium Parvum Calcium Dependent Protein Ki | 2e-06 | ||
| 3f3z_A | 277 | Crystal Structure Of Cryptosporidium Parvum Calcium | 3e-06 | ||
| 3e7o_A | 360 | Crystal Structure Of Jnk2 Length = 360 | 3e-06 | ||
| 3ujg_A | 361 | Crystal Structure Of Snrk2.6 In Complex With Hab1 L | 3e-06 | ||
| 3uc4_A | 362 | The Crystal Structure Of Snf1-Related Kinase 2.6 Le | 3e-06 | ||
| 3udb_A | 317 | Crystal Structure Of Snrk2.6 Length = 317 | 3e-06 | ||
| 3zuu_A | 362 | The Structure Of Ost1 (D160a, S175d) Kinase In Comp | 3e-06 | ||
| 3zut_A | 362 | The Structure Of Ost1 (D160a) Kinase Length = 362 | 3e-06 | ||
| 2fso_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a) A | 3e-06 | ||
| 2fsl_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a+f3 | 3e-06 | ||
| 2fst_X | 367 | Mitogen Activated Protein Kinase P38alpha (d176a+f3 | 3e-06 | ||
| 3vum_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M7 | 3e-06 | ||
| 3vul_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 3e-06 | ||
| 1lew_A | 360 | Crystal Structure Of Map Kinase P38 Complexed To Th | 3e-06 | ||
| 3tg1_A | 380 | Crystal Structure Of P38alpha In Complex With A Map | 3e-06 | ||
| 3p4k_A | 370 | The Third Conformation Of P38a Map Kinase Observed | 3e-06 | ||
| 2puu_A | 348 | Crystal Structure Of P38 Complex With 1-(5-Tert-But | 3e-06 | ||
| 2oza_B | 366 | Structure Of P38alpha Complex Length = 366 | 3e-06 | ||
| 2gtm_A | 348 | Mutated Mouse P38 Map Kinase Domain In Complex With | 3e-06 | ||
| 1bmk_A | 379 | The Complex Structure Of The Map Kinase P38SB218655 | 3e-06 | ||
| 2bal_A | 365 | P38alpha Map Kinase Bound To Pyrazoloamine Length = | 3e-06 | ||
| 2baq_A | 365 | P38alpha Bound To Ro3201195 Length = 365 | 3e-06 | ||
| 2baj_A | 365 | P38alpha Bound To Pyrazolourea Length = 365 | 3e-06 | ||
| 1zzl_A | 351 | Crystal Structure Of P38 With Triazolopyridine Leng | 3e-06 | ||
| 1oz1_A | 372 | P38 Mitogen-Activated Kinase In Complex With 4-Azai | 3e-06 | ||
| 1ove_A | 366 | The Structure Of P38 Alpha In Complex With A Dihydr | 3e-06 | ||
| 1ian_A | 366 | Human P38 Map Kinase Inhibitor Complex Length = 366 | 3e-06 | ||
| 1m7q_A | 366 | Crystal Structure Of P38 Map Kinase In Complex With | 3e-06 | ||
| 2lgc_A | 359 | Joint Nmr And X-Ray Refinement Reveals The Structur | 3e-06 | ||
| 4ewq_A | 383 | Human P38 Alpha Mapk In Complex With A Pyridazine B | 3e-06 | ||
| 3zsg_A | 362 | X-Ray Structure Of P38alpha Bound To Tak-715 Length | 3e-06 | ||
| 3s3i_A | 349 | P38 Kinase Crystal Structure In Complex With Small | 3e-06 | ||
| 2y8o_A | 362 | Crystal Structure Of Human P38alpha Complexed With | 3e-06 | ||
| 3oef_X | 360 | Crystal Structure Of Y323f Inactive Mutant Of P38al | 3e-06 | ||
| 3odz_X | 360 | Crystal Structure Of P38alpha Y323r Active Mutant L | 3e-06 | ||
| 3ody_X | 360 | Crystal Structure Of P38alpha Y323q Active Mutant L | 3e-06 | ||
| 3od6_X | 360 | Crystal Structure Of P38alpha Y323t Active Mutant L | 3e-06 | ||
| 3nnu_A | 354 | Crystal Structure Of P38 Alpha In Complex With Dp13 | 3e-06 | ||
| 3mpt_A | 371 | Crystal Structure Of P38 Kinase In Complex With A P | 3e-06 | ||
| 3mh0_A | 360 | Mutagenesis Of P38 Map Kinase Eshtablishes Key Role | 3e-06 | ||
| 3fi4_A | 372 | P38 Kinase Crystal Structure In Complex With Ro4499 | 3e-06 | ||
| 3kq7_A | 380 | Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ | 3e-06 | ||
| 3k3i_A | 350 | P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 | 3e-06 | ||
| 3k3j_A | 362 | P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 | 3e-06 | ||
| 3hec_A | 348 | P38 In Complex With Imatinib Length = 348 | 3e-06 | ||
| 3gi3_A | 360 | Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana | 3e-06 | ||
| 3hrb_A | 359 | P38 Kinase Crystal Structure In Complex With Small | 3e-06 | ||
| 3gcu_A | 360 | Human P38 Map Kinase In Complex With Rl48 Length = | 3e-06 | ||
| 3gcp_A | 360 | Human P38 Map Kinase In Complex With Sb203580 Lengt | 3e-06 | ||
| 3dt1_A | 383 | P38 Complexed With A Quinazoline Inhibitor Length = | 3e-06 | ||
| 3e92_A | 371 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-06 | ||
| 3d83_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-06 | ||
| 3d7z_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-06 | ||
| 3hvc_A | 362 | Crystal Structure Of Human P38alpha Map Kinase Leng | 3e-06 | ||
| 3mh1_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-06 | ||
| 2npq_A | 367 | A Novel Lipid Binding Site In The P38 Alpha Map Kin | 3e-06 | ||
| 3o8p_A | 360 | Conformational Plasticity Of P38 Map Kinase Dfg Mot | 3e-06 | ||
| 3mh2_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-06 | ||
| 3mh3_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-06 | ||
| 2gfs_A | 372 | P38 Kinase Crystal Structure In Complex With Ro3201 | 3e-06 | ||
| 1bl6_A | 379 | The Complex Structure Of The Map Kinase P38SB216995 | 3e-06 | ||
| 1di9_A | 360 | The Structure Of P38 Mitogen-Activated Protein Kina | 3e-06 | ||
| 2y94_A | 476 | Structure Of An Active Form Of Mammalian Ampk Lengt | 4e-06 | ||
| 3npc_A | 364 | Crystal Structure Of Jnk2 Complexed With Birb796 Le | 4e-06 | ||
| 2h6d_A | 276 | Protein Kinase Domain Of The Human 5'-Amp-Activated | 4e-06 | ||
| 3v3v_A | 379 | Structural And Functional Analysis Of Quercetagetin | 4e-06 | ||
| 4exu_A | 371 | Mapk13, Inactive Form Length = 371 | 5e-06 | ||
| 3coi_A | 353 | Crystal Structure Of P38delta Kinase Length = 353 | 5e-06 | ||
| 3py3_A | 380 | Crystal Structure Of Phosphorylated P38alpha Map Ki | 5e-06 | ||
| 2jav_A | 279 | Human Kinase With Pyrrole-Indolinone Ligand Length | 6e-06 | ||
| 3nnx_A | 354 | Crystal Structure Of Phosphorylated P38 Alpha In Co | 6e-06 | ||
| 4a4x_A | 279 | Nek2-Ede Bound To Cct248662 Length = 279 | 6e-06 | ||
| 2yza_A | 276 | Crystal Structure Of Kinase Domain Of Human 5'-Amp- | 7e-06 | ||
| 3cik_A | 689 | Human Grk2 In Complex With Gbetagamma Subunits Leng | 7e-06 | ||
| 1omw_A | 689 | Crystal Structure Of The Complex Between G Protein- | 7e-06 | ||
| 3psc_A | 695 | Bovine Grk2 In Complex With Gbetagamma Subunits Len | 7e-06 | ||
| 3krw_A | 688 | Human Grk2 In Complex With Gbetgamma Subunits And B | 7e-06 | ||
| 3oht_A | 389 | Crystal Structure Of Salmo Salar P38alpha Length = | 8e-06 | ||
| 2j7t_A | 302 | Crystal Structure Of Human Serine Threonine Kinase- | 8e-06 | ||
| 4bc6_A | 293 | Crystal Structure Of Human Serine Threonine Kinase- | 9e-06 | ||
| 2xs0_A | 386 | Linear Binding Motifs For Jnk And For Calcineurin A | 9e-06 | ||
| 2w4o_A | 349 | Crystal Structure Of Human Camk4 In Complex With 4- | 1e-05 | ||
| 3gc9_A | 370 | The Structure Of P38beta C119s, C162s In Complex Wi | 1e-05 | ||
| 3gc8_A | 370 | The Structure Of P38beta C162s In Complex With A Di | 1e-05 | ||
| 3gp0_A | 348 | Crystal Structure Of Human Mitogen Activated Protei | 1e-05 | ||
| 3vuk_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M5 | 1e-05 | ||
| 3vui_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 1e-05 | ||
| 3vuh_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M3 | 1e-05 | ||
| 3vug_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 1e-05 | ||
| 3vud_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 1e-05 | ||
| 3dls_A | 335 | Crystal Structure Of Human Pas Kinase Bound To Adp | 2e-05 | ||
| 3hko_A | 345 | Crystal Structure Of A Cdpk Kinase Domain From Cryp | 2e-05 | ||
| 1ukh_A | 369 | Structural Basis For The Selective Inhibition Of Jn | 2e-05 | ||
| 2xrw_A | 371 | Linear Binding Motifs For Jnk And For Calcineurin A | 2e-05 | ||
| 4azf_A | 417 | Human Dyrk2 In Complex With Leucettine L41 Length = | 2e-05 | ||
| 3kvw_A | 429 | Crystal Structure Of Dual-Specificity Tyrosine Phos | 2e-05 | ||
| 3oz6_A | 388 | Crystal Structure Of Mapk From Cryptosporidium Parv | 3e-05 | ||
| 3k2l_A | 429 | Crystal Structure Of Dual-Specificity Tyrosine Phos | 3e-05 | ||
| 4eqm_A | 294 | Structural Analysis Of Staphylococcus Aureus Serine | 3e-05 | ||
| 1kob_A | 387 | Twitchin Kinase Fragment (Aplysia), Autoregulated P | 3e-05 | ||
| 2vd5_A | 412 | Structure Of Human Myotonic Dystrophy Protein Kinas | 4e-05 | ||
| 1cm8_A | 367 | Phosphorylated Map Kinase P38-Gamma Length = 367 | 4e-05 | ||
| 3dtc_A | 271 | Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp | 5e-05 | ||
| 4h3q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 7e-05 | ||
| 1wzy_A | 368 | Crystal Structure Of Human Erk2 Complexed With A Py | 7e-05 | ||
| 1tvo_A | 368 | The Structure Of Erk2 In Complex With A Small Molec | 7e-05 | ||
| 1gol_A | 364 | Coordinates Of Rat Map Kinase Erk2 With An Arginine | 7e-05 | ||
| 4fv6_A | 360 | Crystal Structure Of The Erk2 Complexed With E57 Le | 7e-05 | ||
| 4gsb_A | 364 | Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 | 7e-05 | ||
| 4fv7_A | 360 | Crystal Structure Of The Erk2 Complexed With E94 Le | 7e-05 | ||
| 4fux_A | 360 | Crystal Structure Of The Erk2 Complexed With E75 Le | 7e-05 | ||
| 3tei_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 7e-05 | ||
| 3zu7_A | 365 | Crystal Structure Of A Designed Selected Ankyrin Re | 7e-05 | ||
| 2y9q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 7e-05 | ||
| 3sa0_A | 360 | Complex Of Erk2 With Norathyriol Length = 360 | 7e-05 | ||
| 3qyw_A | 364 | Crystal Structure Of Erk2 In Complex With An Inhibi | 7e-05 | ||
| 3r63_A | 358 | Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | 7e-05 | ||
| 2z7l_A | 366 | Unphosphorylated Mitogen Activated Protein Kinase E | 7e-05 | ||
| 3c9w_A | 357 | Crystal Structure Of Erk-2 With Hypothemycin Covale | 7e-05 | ||
| 2ojg_A | 380 | Crystal Structure Of Erk2 In Complex With N,n-dimet | 7e-05 | ||
| 2gph_A | 364 | Docking Motif Interactions In The Map Kinase Erk2 L | 7e-05 | ||
| 2fys_B | 364 | Crystal Structure Of Erk2 Complex With Kim Peptide | 7e-05 | ||
| 1pme_A | 380 | Structure Of Penta Mutant Human Erk2 Map Kinase Com | 7e-05 | ||
| 3o71_A | 358 | Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length | 7e-05 | ||
| 3is5_A | 285 | Crystal Structure Of Cdpk Kinase Domain From Toxopl | 8e-05 | ||
| 4apc_A | 350 | Crystal Structure Of Human Nima-Related Kinase 1 (N | 9e-05 | ||
| 3h4j_B | 336 | Crystal Structure Of Pombe Ampk Kdaid Fragment Leng | 1e-04 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 1e-04 | ||
| 3zuv_A | 364 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-04 | ||
| 2erk_A | 365 | Phosphorylated Map Kinase Erk2 Length = 365 | 1e-04 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 1e-04 | ||
| 1u5q_A | 348 | Crystal Structure Of The Tao2 Kinase Domain: Activa | 1e-04 | ||
| 2gcd_A | 309 | Tao2 Kinase Domain-Staurosporine Structure Length = | 1e-04 | ||
| 3hyh_A | 275 | Crystal Structure Of The Protein Kinase Domain Of Y | 2e-04 | ||
| 1zy4_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 2e-04 | ||
| 3dae_A | 283 | Crystal Structure Of Phosphorylated Snf1 Kinase Dom | 2e-04 | ||
| 2fh9_A | 274 | Structure And Dimerization Of The Kinase Domain Fro | 2e-04 | ||
| 3mn3_A | 271 | An Inhibited Conformation For The Protein Kinase Do | 2e-04 | ||
| 1zyc_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 2e-04 | ||
| 1tki_A | 321 | Autoinhibited Serine Kinase Domain Of The Giant Mus | 2e-04 | ||
| 1ywn_A | 316 | Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p | 2e-04 | ||
| 1y6a_A | 366 | Crystal Structure Of Vegfr2 In Complex With A 2-Ani | 2e-04 | ||
| 3vhk_A | 368 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 3vid_A | 356 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 2e-04 | ||
| 3vnt_A | 318 | Crystal Structure Of The Kinase Domain Of Human Veg | 2e-04 | ||
| 3u6j_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 3vhe_A | 359 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 2e-04 | ||
| 2xir_A | 316 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 3ewh_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 2oh4_A | 316 | Crystal Structure Of Vegfr2 With A Benzimidazole-Ur | 2e-04 | ||
| 2p2i_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 2p2h_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 1vr2_A | 316 | Human Vascular Endothelial Growth Factor Receptor 2 | 2e-04 | ||
| 4agc_A | 353 | Crystal Structure Of Vegfr2 (Juxtamembrane And Kina | 2e-04 | ||
| 3c7q_A | 316 | Structure Of Vegfr2 Kinase Domain In Complex With B | 2e-04 | ||
| 3dk6_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-04 | ||
| 3dk3_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-04 | ||
| 3dk7_A | 277 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 3e-04 | ||
| 2zoq_A | 382 | Structural Dissection Of Human Mitogen-Activated Ki | 3e-04 | ||
| 2pwl_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 4g3d_A | 371 | Crystal Structure Of Human Nf-kappab Inducing Kinas | 3e-04 | ||
| 4dn5_A | 356 | Crystal Structure Of Nf-kb-inducing Kinase (nik) Le | 3e-04 | ||
| 2pvf_A | 334 | Crystal Structure Of Tyrosine Phosphorylated Activa | 3e-04 | ||
| 3cly_A | 334 | Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase | 3e-04 | ||
| 2pzp_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 2pvy_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 2q0b_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 2pzr_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 2pz5_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 3ri1_A | 313 | Crystal Structure Of The Catalytic Domain Of Fgfr2 | 3e-04 | ||
| 2py3_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-04 | ||
| 1gjo_A | 316 | The Fgfr2 Tyrosine Kinase Domain Length = 316 | 3e-04 | ||
| 3aln_A | 327 | Crystal Structure Of Human Non-Phosphorylated Mkk4 | 3e-04 | ||
| 3b2t_A | 311 | Structure Of Phosphotransferase Length = 311 | 3e-04 | ||
| 3pze_A | 358 | Jnk1 In Complex With Inhibitor Length = 358 | 4e-04 | ||
| 3elj_A | 369 | Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine | 4e-04 | ||
| 2g01_A | 370 | Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit | 4e-04 | ||
| 2psq_A | 370 | Crystal Structure Of Unphosphorylated Unactivated W | 4e-04 | ||
| 3o17_A | 370 | Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 | 4e-04 | ||
| 4h36_A | 356 | Crystal Structure Of Jnk3 In Complex With Atf2 Pept | 4e-04 | ||
| 1pmn_A | 364 | Crystal Structure Of Jnk3 In Complex With An Imidaz | 4e-04 | ||
| 3oxi_A | 362 | Design And Synthesis Of Disubstituted Thiophene And | 4e-04 | ||
| 3ptg_A | 363 | Design And Synthesis Of A Novel, Orally Efficacious | 4e-04 | ||
| 3kvx_A | 364 | Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le | 4e-04 | ||
| 3fv8_A | 355 | Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le | 4e-04 | ||
| 3fi3_A | 364 | Crystal Structure Of Jnk3 With Indazole Inhibitor, | 4e-04 | ||
| 3fi2_A | 353 | Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib | 4e-04 | ||
| 2r9s_A | 356 | C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu | 4e-04 | ||
| 1jnk_A | 423 | The C-Jun N-Terminal Kinase (Jnk3s) Complexed With | 4e-04 | ||
| 2o0u_A | 364 | Crystal Structure Of Human Jnk3 Complexed With N-{3 | 4e-04 | ||
| 2ok1_A | 365 | Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 | 4e-04 | ||
| 2exc_X | 356 | Inhibitor Complex Of Jnk3 Length = 356 | 4e-04 | ||
| 2b1p_A | 355 | Inhibitor Complex Of Jnk3 Length = 355 | 4e-04 | ||
| 3ttj_A | 464 | Crystal Structure Of Jnk3 Complexed With Cc-359, A | 4e-04 | ||
| 4f63_A | 309 | Crystal Structure Of Human Fibroblast Growth Factor | 6e-04 | ||
| 3rhx_B | 306 | Crystal Structure Of The Catalytic Domain Of Fgfr1 | 6e-04 | ||
| 3kxx_A | 317 | Structure Of The Mutant Fibroblast Growth Factor Re | 6e-04 | ||
| 3js2_A | 317 | Crystal Structure Of Minimal Kinase Domain Of Fibro | 6e-04 | ||
| 3gql_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 6e-04 | ||
| 3gqi_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 6e-04 | ||
| 1fgk_A | 310 | Crystal Structure Of The Tyrosine Kinase Domain Of | 6e-04 | ||
| 3kmw_A | 271 | Crystal Structure Of The IlkALPHA-Parvin Core Compl | 6e-04 | ||
| 1zxe_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 9e-04 | ||
| 3gvu_A | 292 | The Crystal Structure Of Human Abl2 In Complex With | 9e-04 |
| >pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 | Back alignment and structure |
|
| >pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 | Back alignment and structure |
| >pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 | Back alignment and structure |
| >pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 | Back alignment and structure |
| >pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 | Back alignment and structure |
| >pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 | Back alignment and structure |
| >pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 | Back alignment and structure |
| >pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 | Back alignment and structure |
| >pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 | Back alignment and structure |
| >pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 | Back alignment and structure |
| >pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 | Back alignment and structure |
| >pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 | Back alignment and structure |
| >pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 | Back alignment and structure |
| >pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 | Back alignment and structure |
| >pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 | Back alignment and structure |
| >pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 | Back alignment and structure |
| >pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 | Back alignment and structure |
| >pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 | Back alignment and structure |
| >pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 | Back alignment and structure |
| >pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 | Back alignment and structure |
| >pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 | Back alignment and structure |
| >pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 | Back alignment and structure |
| >pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 | Back alignment and structure |
| >pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 | Back alignment and structure |
| >pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 | Back alignment and structure |
| >pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 | Back alignment and structure |
| >pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 | Back alignment and structure |
| >pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 | Back alignment and structure |
| >pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 | Back alignment and structure |
| >pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 | Back alignment and structure |
| >pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 | Back alignment and structure |
| >pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 | Back alignment and structure |
| >pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 | Back alignment and structure |
| >pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 | Back alignment and structure |
| >pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 | Back alignment and structure |
| >pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 | Back alignment and structure |
| >pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 | Back alignment and structure |
| >pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 | Back alignment and structure |
| >pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 | Back alignment and structure |
| >pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 | Back alignment and structure |
| >pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 | Back alignment and structure |
| >pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 | Back alignment and structure |
| >pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 | Back alignment and structure |
| >pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 | Back alignment and structure |
| >pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 | Back alignment and structure |
| >pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 | Back alignment and structure |
| >pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 | Back alignment and structure |
| >pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 | Back alignment and structure |
| >pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 | Back alignment and structure |
| >pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 | Back alignment and structure |
| >pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 | Back alignment and structure |
| >pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 | Back alignment and structure |
| >pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 | Back alignment and structure |
| >pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 | Back alignment and structure |
| >pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 | Back alignment and structure |
| >pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 | Back alignment and structure |
| >pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 | Back alignment and structure |
| >pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 | Back alignment and structure |
| >pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 | Back alignment and structure |
| >pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 | Back alignment and structure |
| >pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 | Back alignment and structure |
| >pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 | Back alignment and structure |
| >pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 | Back alignment and structure |
| >pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 | Back alignment and structure |
| >pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 | Back alignment and structure |
| >pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 | Back alignment and structure |
| >pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 | Back alignment and structure |
| >pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 | Back alignment and structure |
| >pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 | Back alignment and structure |
| >pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 | Back alignment and structure |
| >pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 | Back alignment and structure |
| >pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 | Back alignment and structure |
| >pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 | Back alignment and structure |
| >pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 | Back alignment and structure |
| >pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 | Back alignment and structure |
| >pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 | Back alignment and structure |
| >pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 | Back alignment and structure |
| >pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 | Back alignment and structure |
| >pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 | Back alignment and structure |
| >pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 | Back alignment and structure |
| >pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 | Back alignment and structure |
| >pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 | Back alignment and structure |
| >pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 | Back alignment and structure |
| >pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
| >pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 | Back alignment and structure |
| >pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 | Back alignment and structure |
| >pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 | Back alignment and structure |
| >pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 | Back alignment and structure |
| >pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 | Back alignment and structure |
| >pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 | Back alignment and structure |
| >pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 | Back alignment and structure |
| >pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 | Back alignment and structure |
| >pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 | Back alignment and structure |
| >pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 | Back alignment and structure |
| >pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 | Back alignment and structure |
| >pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 | Back alignment and structure |
| >pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 | Back alignment and structure |
| >pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 | Back alignment and structure |
| >pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
| >pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | Back alignment and structure |
| >pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | Back alignment and structure |
| >pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 | Back alignment and structure |
| >pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 | Back alignment and structure |
| >pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 | Back alignment and structure |
| >pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 | Back alignment and structure |
| >pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 | Back alignment and structure |
| >pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 | Back alignment and structure |
| >pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 | Back alignment and structure |
| >pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 | Back alignment and structure |
| >pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 | Back alignment and structure |
| >pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 | Back alignment and structure |
| >pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 | Back alignment and structure |
| >pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 | Back alignment and structure |
| >pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 | Back alignment and structure |
| >pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 | Back alignment and structure |
| >pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 | Back alignment and structure |
| >pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 | Back alignment and structure |
| >pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 | Back alignment and structure |
| >pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 | Back alignment and structure |
| >pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 | Back alignment and structure |
| >pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 | Back alignment and structure |
| >pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 | Back alignment and structure |
| >pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 | Back alignment and structure |
| >pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 | Back alignment and structure |
| >pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 | Back alignment and structure |
| >pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 | Back alignment and structure |
| >pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 | Back alignment and structure |
| >pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 | Back alignment and structure |
| >pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 | Back alignment and structure |
| >pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 | Back alignment and structure |
| >pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 | Back alignment and structure |
| >pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 | Back alignment and structure |
| >pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 | Back alignment and structure |
| >pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 | Back alignment and structure |
| >pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 | Back alignment and structure |
| >pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 | Back alignment and structure |
| >pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 | Back alignment and structure |
| >pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 | Back alignment and structure |
| >pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 | Back alignment and structure |
| >pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 | Back alignment and structure |
| >pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 | Back alignment and structure |
| >pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 | Back alignment and structure |
| >pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 | Back alignment and structure |
| >pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 | Back alignment and structure |
| >pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 | Back alignment and structure |
| >pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 | Back alignment and structure |
| >pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 | Back alignment and structure |
| >pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 | Back alignment and structure |
| >pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 | Back alignment and structure |
| >pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 | Back alignment and structure |
| >pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 | Back alignment and structure |
| >pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 | Back alignment and structure |
| >pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 | Back alignment and structure |
| >pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 | Back alignment and structure |
| >pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 | Back alignment and structure |
| >pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 | Back alignment and structure |
| >pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 | Back alignment and structure |
| >pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 | Back alignment and structure |
| >pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 | Back alignment and structure |
| >pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 | Back alignment and structure |
| >pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 | Back alignment and structure |
| >pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 | Back alignment and structure |
| >pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 | Back alignment and structure |
| >pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 | Back alignment and structure |
| >pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 | Back alignment and structure |
| >pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 | Back alignment and structure |
| >pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 | Back alignment and structure |
| >pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 | Back alignment and structure |
| >pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 | Back alignment and structure |
| >pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 | Back alignment and structure |
| >pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 | Back alignment and structure |
| >pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 | Back alignment and structure |
| >pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 | Back alignment and structure |
| >pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 | Back alignment and structure |
| >pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 | Back alignment and structure |
| >pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 | Back alignment and structure |
| >pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 | Back alignment and structure |
| >pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 | Back alignment and structure |
| >pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 | Back alignment and structure |
| >pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 | Back alignment and structure |
| >pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 | Back alignment and structure |
| >pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 | Back alignment and structure |
| >pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 | Back alignment and structure |
| >pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 | Back alignment and structure |
| >pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 | Back alignment and structure |
| >pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 | Back alignment and structure |
| >pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 | Back alignment and structure |
| >pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 | Back alignment and structure |
| >pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 | Back alignment and structure |
| >pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 | Back alignment and structure |
| >pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 | Back alignment and structure |
| >pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 | Back alignment and structure |
| >pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 | Back alignment and structure |
| >pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 | Back alignment and structure |
| >pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 | Back alignment and structure |
| >pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 | Back alignment and structure |
| >pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 | Back alignment and structure |
| >pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 | Back alignment and structure |
| >pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 | Back alignment and structure |
| >pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 | Back alignment and structure |
| >pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 | Back alignment and structure |
| >pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 | Back alignment and structure |
| >pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 | Back alignment and structure |
| >pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 | Back alignment and structure |
| >pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 | Back alignment and structure |
| >pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 | Back alignment and structure |
| >pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 | Back alignment and structure |
| >pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 | Back alignment and structure |
| >pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 | Back alignment and structure |
| >pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 | Back alignment and structure |
| >pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 | Back alignment and structure |
| >pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 | Back alignment and structure |
| >pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 | Back alignment and structure |
| >pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 | Back alignment and structure |
| >pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 | Back alignment and structure |
| >pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 | Back alignment and structure |
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 | Back alignment and structure |
| >pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 | Back alignment and structure |
| >pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 | Back alignment and structure |
| >pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | Back alignment and structure |
| >pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 | Back alignment and structure |
| >pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 | Back alignment and structure |
| >pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 | Back alignment and structure |
| >pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 | Back alignment and structure |
| >pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 | Back alignment and structure |
| >pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 | Back alignment and structure |
| >pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 | Back alignment and structure |
| >pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 | Back alignment and structure |
| >pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 | Back alignment and structure |
| >pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 | Back alignment and structure |
| >pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 | Back alignment and structure |
| >pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 | Back alignment and structure |
| >pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 | Back alignment and structure |
| >pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 | Back alignment and structure |
| >pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 | Back alignment and structure |
| >pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 | Back alignment and structure |
| >pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 | Back alignment and structure |
| >pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 | Back alignment and structure |
| >pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 | Back alignment and structure |
| >pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 | Back alignment and structure |
| >pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 | Back alignment and structure |
| >pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 | Back alignment and structure |
| >pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 | Back alignment and structure |
| >pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 | Back alignment and structure |
| >pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 | Back alignment and structure |
| >pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 | Back alignment and structure |
| >pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 | Back alignment and structure |
| >pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 | Back alignment and structure |
| >pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 | Back alignment and structure |
| >pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 | Back alignment and structure |
| >pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 | Back alignment and structure |
| >pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 | Back alignment and structure |
| >pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 | Back alignment and structure |
| >pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 | Back alignment and structure |
| >pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 | Back alignment and structure |
| >pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 | Back alignment and structure |
| >pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 | Back alignment and structure |
| >pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 | Back alignment and structure |
| >pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 | Back alignment and structure |
| >pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 | Back alignment and structure |
| >pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 | Back alignment and structure |
| >pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 | Back alignment and structure |
| >pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 | Back alignment and structure |
| >pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 | Back alignment and structure |
| >pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 | Back alignment and structure |
| >pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 | Back alignment and structure |
| >pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 | Back alignment and structure |
| >pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 | Back alignment and structure |
| >pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 | Back alignment and structure |
| >pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 | Back alignment and structure |
| >pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 | Back alignment and structure |
| >pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 | Back alignment and structure |
| >pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 | Back alignment and structure |
| >pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 | Back alignment and structure |
| >pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 | Back alignment and structure |
| >pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 | Back alignment and structure |
| >pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 | Back alignment and structure |
| >pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 | Back alignment and structure |
| >pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 | Back alignment and structure |
| >pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 | Back alignment and structure |
| >pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 | Back alignment and structure |
| >pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 | Back alignment and structure |
| >pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 | Back alignment and structure |
| >pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 | Back alignment and structure |
| >pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 | Back alignment and structure |
| >pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 | Back alignment and structure |
| >pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 | Back alignment and structure |
| >pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 | Back alignment and structure |
| >pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 | Back alignment and structure |
| >pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 | Back alignment and structure |
| >pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 | Back alignment and structure |
| >pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 | Back alignment and structure |
| >pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 | Back alignment and structure |
| >pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 | Back alignment and structure |
| >pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 | Back alignment and structure |
| >pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 | Back alignment and structure |
| >pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 | Back alignment and structure |
| >pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 | Back alignment and structure |
| >pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 | Back alignment and structure |
| >pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 | Back alignment and structure |
| >pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 | Back alignment and structure |
| >pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 | Back alignment and structure |
| >pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 | Back alignment and structure |
| >pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 | Back alignment and structure |
| >pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 | Back alignment and structure |
| >pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 | Back alignment and structure |
| >pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 | Back alignment and structure |
| >pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 | Back alignment and structure |
| >pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 | Back alignment and structure |
| >pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 | Back alignment and structure |
| >pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 | Back alignment and structure |
| >pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 | Back alignment and structure |
| >pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 | Back alignment and structure |
| >pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 | Back alignment and structure |
| >pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 | Back alignment and structure |
| >pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 | Back alignment and structure |
| >pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 | Back alignment and structure |
| >pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 | Back alignment and structure |
| >pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 | Back alignment and structure |
| >pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 | Back alignment and structure |
| >pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 | Back alignment and structure |
| >pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 | Back alignment and structure |
| >pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | Back alignment and structure |
| >pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 | Back alignment and structure |
| >pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 | Back alignment and structure |
| >pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 | Back alignment and structure |
| >pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 | Back alignment and structure |
| >pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 | Back alignment and structure |
| >pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 | Back alignment and structure |
| >pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 | Back alignment and structure |
| >pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 | Back alignment and structure |
| >pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 | Back alignment and structure |
| >pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 | Back alignment and structure |
| >pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 | Back alignment and structure |
| >pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 | Back alignment and structure |
| >pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 | Back alignment and structure |
| >pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 | Back alignment and structure |
| >pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 | Back alignment and structure |
| >pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 | Back alignment and structure |
| >pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 | Back alignment and structure |
| >pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 | Back alignment and structure |
| >pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 | Back alignment and structure |
| >pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 | Back alignment and structure |
| >pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 | Back alignment and structure |
| >pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 | Back alignment and structure |
| >pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 | Back alignment and structure |
| >pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 | Back alignment and structure |
| >pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 | Back alignment and structure |
| >pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 | Back alignment and structure |
| >pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 | Back alignment and structure |
| >pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 | Back alignment and structure |
| >pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 | Back alignment and structure |
| >pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 | Back alignment and structure |
| >pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 | Back alignment and structure |
| >pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 | Back alignment and structure |
| >pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 | Back alignment and structure |
| >pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 | Back alignment and structure |
| >pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 | Back alignment and structure |
| >pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 | Back alignment and structure |
| >pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 | Back alignment and structure |
| >pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 | Back alignment and structure |
| >pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 | Back alignment and structure |
| >pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 | Back alignment and structure |
| >pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 | Back alignment and structure |
| >pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 | Back alignment and structure |
| >pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 | Back alignment and structure |
| >pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 | Back alignment and structure |
| >pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 | Back alignment and structure |
| >pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 | Back alignment and structure |
| >pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 | Back alignment and structure |
| >pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 | Back alignment and structure |
| >pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 | Back alignment and structure |
| >pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 | Back alignment and structure |
| >pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 | Back alignment and structure |
| >pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 | Back alignment and structure |
| >pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 | Back alignment and structure |
| >pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 | Back alignment and structure |
| >pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 | Back alignment and structure |
| >pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 | Back alignment and structure |
| >pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 | Back alignment and structure |
| >pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 | Back alignment and structure |
| >pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 | Back alignment and structure |
| >pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 | Back alignment and structure |
| >pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 | Back alignment and structure |
| >pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 | Back alignment and structure |
| >pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 2e-44 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 5e-41 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 1e-38 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 4e-37 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 7e-37 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 1e-36 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 6e-36 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 9e-36 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 1e-35 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 3e-35 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 3e-35 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 7e-35 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 9e-35 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 9e-35 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 2e-34 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 2e-33 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 4e-33 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 2e-32 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 4e-32 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 5e-32 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 5e-32 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 5e-32 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 9e-32 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 1e-31 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 2e-30 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 2e-30 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 2e-30 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 1e-24 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 2e-24 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 2e-24 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 3e-24 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 3e-24 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 4e-24 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 4e-24 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 5e-24 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 5e-24 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 5e-24 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 5e-24 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 6e-24 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 6e-24 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 7e-24 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 1e-23 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 1e-23 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 1e-23 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 2e-23 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 2e-23 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 2e-23 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 4e-23 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 4e-23 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 5e-23 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 5e-23 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 6e-23 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 2e-22 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 2e-22 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 2e-22 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 3e-22 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 3e-22 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 3e-22 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 4e-22 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 5e-22 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 7e-22 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 7e-22 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 7e-22 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 7e-22 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 1e-21 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 2e-21 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 9e-21 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 1e-20 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 1e-20 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 1e-20 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 1e-20 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 1e-20 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 2e-20 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 3e-20 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 4e-20 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 7e-20 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 2e-19 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 2e-19 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 3e-19 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 7e-19 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 7e-19 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 1e-18 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 2e-18 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 2e-18 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 2e-18 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 3e-18 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 4e-18 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 5e-18 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 7e-18 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 1e-17 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 1e-17 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 1e-17 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 7e-17 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 7e-17 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 1e-15 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 2e-15 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 2e-15 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 5e-15 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 5e-15 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 1e-14 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 3e-14 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 4e-14 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 7e-14 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 8e-14 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 2e-13 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 3e-13 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 8e-13 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 9e-13 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 9e-13 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 1e-12 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 1e-12 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 2e-12 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 2e-12 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 3e-12 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 3e-12 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 3e-12 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 3e-12 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 4e-12 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 6e-12 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 8e-12 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 1e-11 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 1e-11 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 2e-11 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 3e-11 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 3e-11 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 4e-11 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 5e-11 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 5e-11 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 8e-11 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 1e-10 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 3e-10 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 3e-10 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 6e-10 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 6e-10 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 2e-09 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 2e-09 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 4e-09 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 7e-09 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 8e-09 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 8e-09 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 1e-08 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 3e-08 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 6e-08 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 7e-08 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 9e-08 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 1e-07 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 4e-07 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 6e-07 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 7e-07 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 1e-06 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 1e-06 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 4e-06 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 5e-06 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 7e-06 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 8e-06 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 8e-06 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 9e-06 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-05 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 2e-05 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 2e-05 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 2e-05 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 2e-05 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 2e-05 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 2e-05 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 2e-05 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 3e-05 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 3e-05 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 3e-05 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 3e-05 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 3e-05 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 3e-05 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 4e-05 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 5e-05 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 5e-05 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 5e-05 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 7e-05 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 7e-05 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 7e-05 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 8e-05 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 9e-05 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 9e-05 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 9e-05 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 1e-04 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 1e-04 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 1e-04 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 1e-04 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 1e-04 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 1e-04 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 1e-04 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 1e-04 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 2e-04 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 2e-04 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 2e-04 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 2e-04 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 2e-04 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 2e-04 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-04 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 2e-04 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 3e-04 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 3e-04 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 3e-04 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 4e-04 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 5e-04 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 5e-04 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 5e-04 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 5e-04 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 5e-04 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 5e-04 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 6e-04 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 6e-04 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 6e-04 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 7e-04 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 8e-04 |
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
Score = 145 bits (369), Expect = 2e-44
Identities = 34/93 (36%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
Query: 3 FSLNSQGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPM 62
F + +TWT CGTPE +APE+IL++G++ + D+W+LGVL++E+ G PPF P+
Sbjct: 185 FGFAKRVKGRTWTLCGTPEALAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPI 244
Query: 63 KTYNIILKGIDAIEFPRNITRNATALIKKLCRR 95
+ Y I+ G + FP + + + L++ L +
Sbjct: 245 QIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQV 275
|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.92 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.92 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.9 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.9 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.9 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.89 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.89 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.89 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.89 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.89 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.89 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.88 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.86 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.86 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.83 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.82 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.81 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.8 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.8 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.8 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.8 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.79 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.79 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.78 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.77 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.77 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.77 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.77 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.77 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.77 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.76 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.75 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.75 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.75 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.75 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.75 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.74 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.74 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.74 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.73 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.73 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.73 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.73 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.73 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.73 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.73 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.73 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.73 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 99.73 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.73 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.72 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.72 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.72 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.72 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.72 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.72 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.71 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.71 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 99.71 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 99.71 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.71 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 99.71 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.71 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.71 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.71 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.71 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.71 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.7 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.7 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.7 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.7 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.7 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.7 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.69 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.69 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.69 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.69 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.69 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.69 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 99.68 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.68 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.68 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.68 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.68 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.68 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.68 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.68 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.68 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.67 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.67 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.67 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.67 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.67 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.67 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.67 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.67 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.67 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.67 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.67 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.67 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.67 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.67 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 99.67 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.67 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.66 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 99.66 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 99.66 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.66 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.66 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.66 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.66 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 99.66 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.66 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.66 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.66 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.66 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 99.65 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.65 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.65 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.65 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 99.65 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.65 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.65 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.65 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.65 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.65 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.65 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.65 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.65 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.65 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.65 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.64 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 99.64 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.64 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.64 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.64 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.64 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 99.64 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 99.64 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.64 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.64 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.63 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.63 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.63 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 99.63 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.63 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.63 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.63 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.63 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.63 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.63 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.63 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 99.63 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 99.63 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.63 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.63 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.63 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.63 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.62 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.62 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.62 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.62 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.62 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.62 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.62 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.62 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.62 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.62 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 99.62 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.62 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.62 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.62 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 99.61 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 99.61 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 99.61 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.61 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.61 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.61 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.61 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.6 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.6 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.6 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 99.6 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 99.6 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 99.6 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 99.6 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.6 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 99.6 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.59 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.59 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.59 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 99.59 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 99.59 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.59 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.59 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 99.59 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.59 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.58 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.58 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.58 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.58 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.58 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.58 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 99.58 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.57 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 99.57 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 99.57 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.57 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 99.57 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 99.55 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.55 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.55 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.55 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 99.55 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.55 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.55 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.54 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 99.54 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.54 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 99.54 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 99.54 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.53 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.53 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.53 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.53 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.53 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.53 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.53 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.53 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.52 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.52 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.51 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.51 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 99.51 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 99.5 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.5 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 99.49 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 99.48 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 99.47 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.47 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.47 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 99.44 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.42 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.42 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.41 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.38 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.23 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 99.03 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.0 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 98.91 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 96.96 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 96.64 |
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
Probab=99.92 E-value=9.7e-25 Score=133.58 Aligned_cols=98 Identities=26% Similarity=0.474 Sum_probs=87.3
Q ss_pred CeeeeecCC---CcceeeeccccccccchhhccCCCCchhHHHHHHHHHHHHHhCCCCCCCCChhhHHHHHHhCCCCcCC
Q psy17576 1 MIFSLNSQG---GRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEF 77 (101)
Q Consensus 1 ~~~~~~~~~---~~~~~~~~gt~~~~~pe~~~~~~~~~~~d~~s~g~~l~~~~~~~~p~~~~~~~~~~~~i~~~~~~~~~ 77 (101)
||+++.... .....+++||+.|++||++....|+.++|+||+|+++|+|++|..||.+.+..+.+.+|..+ ...+
T Consensus 176 FGla~~~~~~~~~~~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i~~~--~~~~ 253 (311)
T 4aw0_A 176 FGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKL--EYDF 253 (311)
T ss_dssp CTTCEECCTTTTCCCBCCCCSCGGGCCHHHHHHSCBCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHT--CCCC
T ss_pred cCCceecCCCCCcccccCcccCcccCCHHHHcCCCCCcHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHcC--CCCC
Confidence 888887643 23456789999999999999999999999999999999999999999999988888888875 4678
Q ss_pred CCccCHHHHHHHHHHHHHhccCC
Q psy17576 78 PRNITRNATALIKKLCRRLTLNT 100 (101)
Q Consensus 78 p~~~~~~~~~li~~~~~~~~~~~ 100 (101)
|..++++++++|++||+++|.+|
T Consensus 254 p~~~s~~~~dli~~lL~~dp~~R 276 (311)
T 4aw0_A 254 PEKFFPKARDLVEKLLVLDATKR 276 (311)
T ss_dssp CTTCCHHHHHHHHHHSCSSGGGS
T ss_pred CcccCHHHHHHHHHHccCCHhHC
Confidence 99999999999999999999887
|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 101 | ||||
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 3e-25 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 9e-24 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 3e-23 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 4e-23 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 6e-23 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 8e-23 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 2e-21 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 7e-21 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 1e-20 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 1e-20 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 2e-20 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 2e-20 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 2e-20 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 5e-20 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 9e-20 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 2e-19 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 2e-19 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 3e-19 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 4e-19 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 2e-18 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 5e-18 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 6e-18 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 1e-17 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 2e-17 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 3e-17 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 3e-17 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 4e-17 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 5e-17 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 5e-17 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 6e-17 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 7e-17 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 9e-17 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 1e-16 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 1e-16 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 1e-16 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 2e-16 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 2e-16 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-16 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 2e-15 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 2e-15 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 2e-15 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 4e-15 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 7e-15 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 1e-14 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 2e-14 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 2e-14 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 2e-14 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 4e-14 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 6e-14 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 9e-14 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 9e-14 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 2e-13 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 2e-13 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 4e-13 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 7e-13 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 9e-13 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 9e-13 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 6e-12 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 1e-11 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 5e-10 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 9e-10 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 1e-09 |
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Aurora-related kinase 1 (aurora-2) species: Human (Homo sapiens) [TaxId: 9606]
Score = 93.1 bits (231), Expect = 3e-25
Identities = 34/86 (39%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
Query: 10 GRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIIL 69
+ T CGT +Y+ PE+I R HD D WSLGVL +E L G PPF + +TY I
Sbjct: 158 SSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRIS 217
Query: 70 KGIDAIEFPRNITRNATALIKKLCRR 95
+ FP +T A LI +L +
Sbjct: 218 RV--EFTFPDFVTEGARDLISRLLKH 241
|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.89 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.88 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.88 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.88 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.87 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.87 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.86 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.86 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.86 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.86 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.85 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.85 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.85 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.85 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.84 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.84 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.84 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.83 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.83 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.83 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.83 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.82 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.82 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.82 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.82 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.82 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.82 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.81 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.81 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.81 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.81 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.81 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.81 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.8 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.79 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.79 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.79 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.79 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.79 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.77 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.77 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 99.76 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.76 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.75 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.72 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.72 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 99.72 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.71 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.67 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.67 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.66 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.66 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.63 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.62 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.59 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.56 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.53 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.53 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.42 |
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Pkb kinase (Akt-2) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89 E-value=5.5e-23 Score=125.69 Aligned_cols=98 Identities=34% Similarity=0.674 Sum_probs=86.5
Q ss_pred CeeeeecCC-CcceeeeccccccccchhhccCCCCchhHHHHHHHHHHHHHhCCCCCCCCChhhHHHHHHhCCCCcCCCC
Q psy17576 1 MIFSLNSQG-GRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPR 79 (101)
Q Consensus 1 ~~~~~~~~~-~~~~~~~~gt~~~~~pe~~~~~~~~~~~d~~s~g~~l~~~~~~~~p~~~~~~~~~~~~i~~~~~~~~~p~ 79 (101)
||+++.... .......+||+.|++||++....|+.++|+||+||++|+|++|+.||.+.+..+....+..+ ...+|.
T Consensus 149 FG~a~~~~~~~~~~~~~~GT~~Y~aPE~~~~~~y~~~~DiwSlGvilyeml~G~~pf~~~~~~~~~~~i~~~--~~~~p~ 226 (337)
T d1o6la_ 149 FGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILME--EIRFPR 226 (337)
T ss_dssp CTTCBCSCCTTCCBCCCEECGGGCCGGGGSSSCBCTTHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHC--CCCCCT
T ss_pred cccccccccCCcccccceeCHHHhhhhhccCCCCChhhcccchhhHHHHHHHCCCCCCCcCHHHHHHHHhcC--CCCCCc
Confidence 778776533 44456789999999999999999999999999999999999999999999988888888775 478899
Q ss_pred ccCHHHHHHHHHHHHHhccCC
Q psy17576 80 NITRNATALIKKLCRRLTLNT 100 (101)
Q Consensus 80 ~~~~~~~~li~~~~~~~~~~~ 100 (101)
.++++++++|++||+++|.+|
T Consensus 227 ~~s~~~~dli~~~L~~dP~~R 247 (337)
T d1o6la_ 227 TLSPEAKSLLAGLLKKDPKQR 247 (337)
T ss_dssp TSCHHHHHHHHHHTCSSTTTS
T ss_pred cCCHHHHHHHHhhccCCchhh
Confidence 999999999999999999887
|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|