Diaphorina citri psyllid: psy17576


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MIFSLNSQGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRRLTLNTG
ccCCccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccc
*IFSLN*QGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRRL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFSLNSQGGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRRLTLNTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 very confidentP32023
cGMP-dependent protein kinase 1 Serine/threonine protein kinasethat acts as key mediator of the nitric oxide (NO)/cGMP signaling pathway. GMP binding activates PRKG1, which phosphorylates serines and threonines on many cellular proteins. Numerous protein targets for PRKG1 phosphorylation are implicated in modulating cellular calcium, but the contribution of each of these targets may vary substantially among cell types. Proteins that are phosphorylated by PRKG1 regulate platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, feedback of the NO-signaling pathway, and other processes involved in several aspects of the CNS like axon guidance, hippocampal and cerebellar learning, circadian rhythm and nociception. Smoth muscle relaxation is mediated through lowering of intracellular free calcium, by desensitization of contractile proteins to calcium, and by decrease in the contractile state of smooth muscle or in platelet activation. Regulates intracellular calcium levels via several pathways: phosphorylates MRVI1/IRAG and inhibits IP3-induced Ca(2+) release from intracellular stores, phosphorylation of KCNMA1 (BKCa) channels decreases intracellular Ca(2+) levels, which leads to increased opening of this channel. PRKG1 phosphorylates the canonical transient receptor potential channel (TRPC) family which inactivates the associated inward calcium current. Another mode of action of NO/cGMP/PKGI signaling involves PKGI-mediated inactivation of the Ras homolog gene family member A (RhoA). Phosphorylation of RHOA by PRKG1 blocks the action of this protein in myriad processes: regulation of RHOA translocation; decreasing contraction; controlling vesicle trafficking, reduction of myosin light chain phosphorylation resulting in vasorelaxation. Activation of PRKG1 by NO signaling alters also gene expression in a number of tissues. In smooth muscle cells, increased cGMP and PRKG1 activity influence expression of smooth muscle-specific contractile proteins, levels of proteins in the NO/cGMP signaling pathway, down-regulation of the matrix proteins osteopontin and thrombospondin-1 to limit smooth muscle cell migration and phenotype. Regulates vasodilator-stimulated phosphoprotein (VASP) functions in platelets and smooth muscle.confidentO77676
cGMP-dependent protein kinase 1 Serine/threonine protein kinasethat acts as key mediator of the nitric oxide (NO)/cGMP signaling pathway. GMP binding activates PRKG1, which phosphorylates serines and threonines on many cellular proteins. Numerous protein targets for PRKG1 phosphorylation are implicated in modulating cellular calcium, but the contribution of each of these targets may vary substantially among cell types. Proteins that are phosphorylated by PRKG1 regulate platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, feedback of the NO-signaling pathway, and other processes involved in several aspects of the CNS like axon guidance, hippocampal and cerebellar learning, circadian rhythm and nociception. Smoth muscle relaxation is mediated through lowering of intracellular free calcium, by desensitization of contractile proteins to calcium, and by decrease in the contractile state of smooth muscle or in platelet activation. Regulates intracellular calcium levels via several pathways: phosphorylates MRVI1/IRAG and inhibits IP3-induced Ca(2+) release from intracellular stores, phosphorylation of KCNMA1 (BKCa) channels decreases intracellular Ca(2+) levels, which leads to increased opening of this channel. PRKG1 phosphorylates the canonical transient receptor potential channel (TRPC) family which inactivates the associated inward calcium current. Another mode of action of NO/cGMP/PKGI signaling involves PKGI-mediated inactivation of the Ras homolog gene family member A (RhoA). Phosphorylation of RHOA by PRKG1 blocks the action of this protein in myriad processes: regulation of RHOA translocation; decreasing contraction; controlling vesicle trafficking, reduction of myosin light chain phosphorylation resulting in vasorelaxation. Activation of PRKG1 by NO signaling alters also gene expression in a number of tissues. In smooth muscle cells, increased cGMP and PRKG1 activity influence expression of smooth muscle-specific contractile proteins, levels of proteins in the NO/cGMP signaling pathway, down-regulation of the matrix proteins osteopontin and thrombospondin-1 to limit smooth muscle cell migration and phenotype. Regulates vasodilator-stimulated phosphoprotein (VASP) functions in platelets and smooth muscle.confidentP00516

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009744 [BP]response to sucrose stimulusconfidentGO:1901700, GO:0009743, GO:0034285, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008345 [BP]larval locomotory behaviorprobableGO:0007626, GO:0030537, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0032095 [BP]regulation of response to foodprobableGO:0032107, GO:0032104, GO:0032101, GO:0048583, GO:0065007, GO:0008150, GO:0050789
GO:0005246 [MF]calcium channel regulator activityprobableGO:0016247, GO:0003674
GO:0004692 [MF]cGMP-dependent protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672, GO:0004690
GO:0030553 [MF]cGMP bindingprobableGO:0043168, GO:0030551, GO:0019001, GO:0097159, GO:0000166, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:0043167, GO:1901363, GO:1901265, GO:0005488
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046959 [BP]habituationprobableGO:0032501, GO:0044707, GO:0007612, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0044699, GO:0046958, GO:0044708, GO:0050877, GO:0003008
GO:0007616 [BP]long-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0007614 [BP]short-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0007631 [BP]feeding behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0008016 [BP]regulation of heart contractionprobableGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789
GO:0016358 [BP]dendrite developmentprobableGO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:2000112 [BP]regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:2000242 [BP]negative regulation of reproductive processprobableGO:0008150, GO:0048519, GO:2000241, GO:0065007, GO:0050789
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0051445 [BP]regulation of meiotic cell cycleprobableGO:0051726, GO:2000241, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0043087 [BP]regulation of GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0050789, GO:0031329, GO:0030811, GO:0065007, GO:0065009, GO:0033121, GO:0033124, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0010631 [BP]epithelial cell migrationprobableGO:0040011, GO:0032501, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0001764 [BP]neuron migrationprobableGO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:2000696 [BP]regulation of epithelial cell differentiation involved in kidney developmentprobableGO:0050793, GO:0090183, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:2000026, GO:0051239, GO:0030856, GO:0050789
GO:0030900 [BP]forebrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0004691 [MF]cAMP-dependent protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672, GO:0004690
GO:0004697 [MF]protein kinase C activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:1901701 [BP]cellular response to oxygen-containing compoundprobableGO:1901700, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0045786 [BP]negative regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0060993 [BP]kidney morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0001822, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0009653, GO:0007275, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0060562 [BP]epithelial tube morphogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0032501, GO:0008150, GO:0048729, GO:0035295, GO:0009653, GO:0007275, GO:0044699
GO:0090331 [BP]negative regulation of platelet aggregationprobableGO:0034111, GO:0034110, GO:0050865, GO:0030155, GO:0048583, GO:0022407, GO:0061041, GO:0050789, GO:0022408, GO:0032101, GO:1900046, GO:0065007, GO:0010543, GO:0048519, GO:0050794, GO:0090330, GO:0008150, GO:0051239, GO:0050818, GO:0080134, GO:0007162, GO:0030193, GO:0048523
GO:0030099 [BP]myeloid cell differentiationprobableGO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007596 [BP]blood coagulationprobableGO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0007281 [BP]germ cell developmentprobableGO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0043900 [BP]regulation of multi-organism processprobableGO:0008150, GO:0065007, GO:0050789
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0048584 [BP]positive regulation of response to stimulusprobableGO:0048518, GO:0065007, GO:0048583, GO:0050789, GO:0008150
GO:0031589 [BP]cell-substrate adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0032268 [BP]regulation of cellular protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789
GO:0023051 [BP]regulation of signalingprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A62, chain A
Confidence level:very confident
Coverage over the Query: 1-5,16-100
View the alignment between query and template
View the model in PyMOL