Diaphorina citri psyllid: psy17590


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKSRYKGVGRGKN
ccccHHHHHHHcHHHHHHHHHHHccEEEEEcEECccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccc
**KSPIHLLALLGEALAQISEYSEAGITVRGIYIP**********KLFLAIESTNELAVSKAKVEITRLIKEELI****************GV*R***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKSRYKGVGRGKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ATP-dependent RNA helicase DDX46 Plays an essential role in splicing, either prior to, or during A complex formation.confidentQ569Z5
Probable ATP-dependent RNA helicase DDX46 Plays an essential role in splicing, either prior to, or during A complex formation.confidentQ5R6D8
Probable ATP-dependent RNA helicase DDX46 Plays an essential role in splicing, either prior to, or during A complex formation.confidentQ62780

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000381 [BP]regulation of alternative mRNA splicing, via spliceosomeprobableGO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0072576 [BP]liver morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0001889, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0008026 [MF]ATP-dependent helicase activityprobableGO:0016787, GO:0016818, GO:0070035, GO:0003824, GO:0042623, GO:0017111, GO:0016817, GO:0004386, GO:0016462, GO:0003674, GO:0016887
GO:0031017 [BP]exocrine pancreas developmentprobableGO:0032502, GO:0055123, GO:0048856, GO:0044707, GO:0048513, GO:0032501, GO:0031016, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0048546 [BP]digestive tract morphogenesisprobableGO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0015030 [CC]Cajal bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K1G, chain A
Confidence level:confident
Coverage over the Query: 9-73
View the alignment between query and template
View the model in PyMOL