Psyllid ID: psy17590


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKSRYKGVGRGKN
ccccHHHHHHHcHHHHHHHHHHHccEEEEEcEEEccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccc
ccccHHHHHHHHHHHHHHHHHHHccEEEEEcEEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccc
MLKSPIHLLALLGEALAQISEYSeagitvrgiyippgknppegeRKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSinksrykgvgrgkn
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTnelavskakVEITRLIKEEliklsssahqsinksrykgvgrgkn
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKSRYKGVGRGKN
*****IHLLALLGEALAQISEYSEAGITVRGIYIP**********KLFLAIESTNELAVSKAKVEITRLIKEELI***********************
**KSPIHLLALLGEALAQISEYSEAGITVRGI***************FLAIESTNELAVSKAKVEITRLI*********************GVGRG**
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKS**********
*LKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKSRYKGV*R***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSAHQSINKSRYKGVGRGKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
Q7L0141031 Probable ATP-dependent RN yes N/A 0.785 0.074 0.730 3e-25
Q569Z51032 Probable ATP-dependent RN yes N/A 0.785 0.074 0.730 3e-25
Q5R6D81032 Probable ATP-dependent RN yes N/A 0.785 0.074 0.730 3e-25
Q627801032 Probable ATP-dependent RN yes N/A 0.785 0.074 0.730 3e-25
Q4TVV31018 Probable ATP-dependent RN yes N/A 0.785 0.075 0.705 5e-24
Q2HAD81064 Pre-mRNA-processing ATP-d N/A N/A 0.765 0.070 0.421 6e-09
Q0J7Y8947 DEAD-box ATP-dependent RN no N/A 0.602 0.062 0.474 7e-08
Q8H0U81166 DEAD-box ATP-dependent RN no N/A 0.602 0.050 0.457 2e-07
A4RN461012 Pre-mRNA-processing ATP-d N/A N/A 0.765 0.074 0.394 2e-07
Q84UQ11049 DEAD-box ATP-dependent RN no N/A 0.602 0.056 0.457 4e-07
>sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 Back     alignment and function desciption
 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 1/78 (1%)

Query: 14   EALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEE 73
            EAL +ISEYSEA IT+RG Y PPGK P EGERK++LAIES NELAV KAK EITRLIKEE
Sbjct: 953  EALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEE 1012

Query: 74   LIKLSSSAHQSINKSRYK 91
            LI+L +S +Q  NK RYK
Sbjct: 1013 LIRLQNS-YQPTNKGRYK 1029




Plays an essential role in splicing, either prior to, or during splicing A complex formation.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 Back     alignment and function description
>sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 Back     alignment and function description
>sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 Back     alignment and function description
>sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 Back     alignment and function description
>sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 Back     alignment and function description
>sp|Q0J7Y8|RH45_ORYSJ DEAD-box ATP-dependent RNA helicase 45 OS=Oryza sativa subsp. japonica GN=Os08g0154200 PE=3 SV=2 Back     alignment and function description
>sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 Back     alignment and function description
>sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 Back     alignment and function description
>sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
193683325 985 PREDICTED: probable ATP-dependent RNA he 0.795 0.079 0.833 2e-30
158289704 968 AGAP010656-PA [Anopheles gambiae str. PE 0.816 0.082 0.8 6e-30
312371167 1161 hypothetical protein AND_22552 [Anophele 0.795 0.067 0.807 9e-30
49072840 1012 DEAD box RNA helicase [Choristoneura fum 0.795 0.077 0.807 3e-29
189240548 984 PREDICTED: similar to DEAD box ATP-depen 0.816 0.081 0.775 1e-28
270011364 1007 hypothetical protein TcasGA2_TC005373 [T 0.816 0.079 0.775 1e-28
357615888 992 DEAD box RNA helicase [Danaus plexippus] 0.795 0.078 0.807 2e-28
170039965 942 conserved hypothetical protein [Culex qu 0.785 0.081 0.807 7e-28
157138330 1029 DEAD box ATP-dependent RNA helicase [Aed 0.795 0.075 0.794 9e-28
389615343181 DEAD box ATP-dependent RNA helicase, par 0.795 0.430 0.794 4e-27
>gi|193683325|ref|XP_001948746.1| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%)

Query: 14  EALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEE 73
           EALAQISEYSEAGITVRG Y PP KNPPEGERKLFLAIEST+ELAVSKAK+EITRLIKEE
Sbjct: 906 EALAQISEYSEAGITVRGTYYPPPKNPPEGERKLFLAIESTDELAVSKAKIEITRLIKEE 965

Query: 74  LIKLSSSAHQSINKSRYK 91
           L+K+ +SAH  +NK+RYK
Sbjct: 966 LLKMQTSAHHMVNKARYK 983




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158289704|ref|XP_311375.4| AGAP010656-PA [Anopheles gambiae str. PEST] gi|157018455|gb|EAA07045.4| AGAP010656-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312371167|gb|EFR19420.1| hypothetical protein AND_22552 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|49072840|gb|AAT51707.1| DEAD box RNA helicase [Choristoneura fumiferana] Back     alignment and taxonomy information
>gi|189240548|ref|XP_973126.2| PREDICTED: similar to DEAD box ATP-dependent RNA helicase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270011364|gb|EFA07812.1| hypothetical protein TcasGA2_TC005373 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357615888|gb|EHJ69887.1| DEAD box RNA helicase [Danaus plexippus] Back     alignment and taxonomy information
>gi|170039965|ref|XP_001847786.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167863566|gb|EDS26949.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157138330|ref|XP_001657248.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108869525|gb|EAT33750.1| AAEL013985-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|389615343|dbj|BAM20650.1| DEAD box ATP-dependent RNA helicase, partial [Papilio polytes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
FB|FBgn00306311224 CG6227 [Drosophila melanogaste 0.806 0.064 0.787 1.4e-25
UNIPROTKB|E1BSC01031 DDX46 "Uncharacterized protein 0.785 0.074 0.730 3.1e-23
UNIPROTKB|Q7L0141031 DDX46 "Probable ATP-dependent 0.785 0.074 0.730 3.1e-23
UNIPROTKB|F1MX401032 DDX46 "Uncharacterized protein 0.785 0.074 0.730 3.1e-23
UNIPROTKB|F1PK901032 DDX46 "Uncharacterized protein 0.785 0.074 0.730 3.1e-23
UNIPROTKB|I3LR201032 DDX46 "Uncharacterized protein 0.785 0.074 0.730 3.1e-23
MGI|MGI:19208951032 Ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.785 0.074 0.730 3.1e-23
RGD|7084801032 Ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.785 0.074 0.730 3.1e-23
UNIPROTKB|Q627801032 Ddx46 "Probable ATP-dependent 0.785 0.074 0.730 3.1e-23
ZFIN|ZDB-GENE-030131-6671035 ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.785 0.074 0.705 2.8e-22
FB|FBgn0030631 CG6227 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 1.4e-25, P = 1.4e-25
 Identities = 63/80 (78%), Positives = 69/80 (86%)

Query:    14 EALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEE 73
             EALAQISEYSEAG+TVRG Y+P GKNPP+GERKL+LAIES +ELAV KAK EITRLIKEE
Sbjct:  1146 EALAQISEYSEAGLTVRGTYVPQGKNPPDGERKLYLAIESCSELAVQKAKREITRLIKEE 1205

Query:    74 LIKLSSSAHQSINKSRYKGV 93
             L+KLSS AH   NK RYK V
Sbjct:  1206 LLKLSS-AHHVFNKGRYKVV 1224




GO:0003729 "mRNA binding" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005634 "nucleus" evidence=IC
UNIPROTKB|E1BSC0 DDX46 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L014 DDX46 "Probable ATP-dependent RNA helicase DDX46" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX40 DDX46 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK90 DDX46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LR20 DDX46 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1920895 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708480 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62780 Ddx46 "Probable ATP-dependent RNA helicase DDX46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-667 ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4TVV3DDX46_DANRE3, ., 6, ., 4, ., 1, 30.70510.78570.0756yesN/A
Q62780DDX46_RAT3, ., 6, ., 4, ., 1, 30.73070.78570.0746yesN/A
Q5R6D8DDX46_PONAB3, ., 6, ., 4, ., 1, 30.73070.78570.0746yesN/A
Q569Z5DDX46_MOUSE3, ., 6, ., 4, ., 1, 30.73070.78570.0746yesN/A
Q7L014DDX46_HUMAN3, ., 6, ., 4, ., 1, 30.73070.78570.0746yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
KOG0334|consensus997 99.78
KOG1960|consensus 531 99.06
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.28
KOG0119|consensus 554 98.12
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 96.87
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 96.53
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 96.48
KOG1588|consensus259 95.7
COG5176269 MSL5 Splicing factor (branch point binding protein 94.69
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 94.52
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 94.35
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 93.36
smart0032269 KH K homology RNA-binding domain. 93.35
PRK13763180 putative RNA-processing protein; Provisional 92.64
KOG1676|consensus 600 89.84
KOG2814|consensus 345 89.2
PRK13763180 putative RNA-processing protein; Provisional 87.9
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 87.19
PF1301443 KH_3: KH domain 84.15
PRK0138199 Trp operon repressor; Provisional 80.75
PF0343984 Spt5-NGN: Early transcription elongation factor of 80.45
>KOG0334|consensus Back     alignment and domain information
Probab=99.78  E-value=6.3e-20  Score=159.93  Aligned_cols=91  Identities=45%  Similarity=0.645  Sum_probs=85.0

Q ss_pred             CchhHHHHhccHHHHHHhHhhhcceeeeeceeeCCCCCCCCCCCceEEEEEeCCHHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17590          2 LKSPIHLLALLGEALAQISEYSEAGITVRGIYIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELIKLSSSA   81 (98)
Q Consensus         2 lpq~~R~~vT~~~tl~~I~e~Tga~It~KG~y~ppg~~p~~ge~kLYL~Ieg~te~~V~~A~~eIk~ii~e~~~~~~~~~   81 (98)
                      +||.+||++|+++++..|.|.++++||+||.|||+++.|.+||++|||+|||.++.+|++|+.++++.+++++.++....
T Consensus       907 ~Pq~~r~~vt~~~~L~~i~e~~~~~it~rg~f~~~gk~p~~gErklyl~ve~~~e~~vqra~~e~~r~l~e~~~~~~~~~  986 (997)
T KOG0334|consen  907 FPQNARWRVTYKEALLRISEPTAAGITTRGKFNPPGKEPKPGERKLYLLVEGPDELSVQRAIEELERLLEEEVVNLFSSL  986 (997)
T ss_pred             cchhcceeeechhhhhhccCccccceeeccccCCCCCCCCCcchhhhhhhhcchhHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999985444


Q ss_pred             cCCCCCCceEEe
Q psy17590         82 HQSINKSRYKGV   93 (98)
Q Consensus        82 ~~~~~~GRY~V~   93 (98)
                       +...+|||.|+
T Consensus       987 -~~~~~~~y~~~  997 (997)
T KOG0334|consen  987 -QPSCKGRYLVV  997 (997)
T ss_pred             -CCCccceeecC
Confidence             44449999986



>KOG1960|consensus Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>PF03439 Spt5-NGN: Early transcription elongation factor of RNA pol II, NGN section; InterPro: IPR005100 Spt5p and prokaryotic NusG are shown to contain a novel 'NGN' domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.79
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.69
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.12
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 97.77
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 97.75
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 97.73
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 97.71
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 97.7
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 97.57
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 97.56
1x4n_A92 FAR upstream element binding protein 1; KH domain, 97.48
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 97.45
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 97.4
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 97.34
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 97.32
1we8_A104 Tudor and KH domain containing protein; structural 97.31
1x4m_A94 FAR upstream element binding protein 1; KH domain, 97.29
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 97.24
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 97.17
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 97.04
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 96.94
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 96.94
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 96.88
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 96.53
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 96.49
1j4w_A174 FUSE binding protein; single-stranded DNA binding 96.41
1j4w_A174 FUSE binding protein; single-stranded DNA binding 96.41
2dgr_A83 Ring finger and KH domain-containing protein 1; st 96.4
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 96.26
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 96.11
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 96.1
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 95.72
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 95.47
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 94.27
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 94.12
2cpq_A91 FragIle X mental retardation syndrome related prot 93.49
3n89_A376 Defective in GERM LINE development protein 3, ISO; 92.93
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 88.34
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 87.77
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 87.52
1wjw_A112 Phosphoacetylglucosamine mutase; carbohydrate meta 86.67
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=98.79  E-value=2.8e-08  Score=67.98  Aligned_cols=64  Identities=19%  Similarity=0.182  Sum_probs=51.4

Q ss_pred             ccHHHHHHhHhhhcceeeeece---eeCCCCCCCCCCCceEEEEEeCCHHHHHHHHHHHHHHHHHHHH
Q psy17590         11 LLGEALAQISEYSEAGITVRGI---YIPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEELI   75 (98)
Q Consensus        11 T~~~tl~~I~e~Tga~It~KG~---y~ppg~~p~~ge~kLYL~Ieg~te~~V~~A~~eIk~ii~e~~~   75 (98)
                      -.+.++.+|+++|||.|.++|+   ++.+.... ..+-+||++|+|.+.+++++|+.+|+.|+.+--.
T Consensus        36 pgG~tiK~I~~eTG~kI~I~G~gS~~~e~~~~~-e~~e~l~V~I~a~~~e~i~~A~~~Ie~Ll~~v~~  102 (119)
T 2yqr_A           36 PGCSYLQHIQIETGAKVFLRGKGSGCIEPASGR-EAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHA  102 (119)
T ss_dssp             GGGHHHHHHHHHHCCEEEEESBTTTCCCTTTSS-CCSSBCEEEEEESSHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCChHHHHHHHHHCCEEEEecCCcccccccccc-ccCCCcEEEEEeCCHHHHHHHHHHHHHHhhchHH
Confidence            3578999999999999999976   33333322 2346899999999999999999999999986443



>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>1wjw_A Phosphoacetylglucosamine mutase; carbohydrate metabolism, structural genomics, riken structural genomics/proteomics initiative, RSGI, isomerase; NMR {Mus musculus} SCOP: d.129.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 99.04
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 98.11
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 98.01
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 97.76
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 97.68
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 97.66
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.62
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 97.59
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 97.54
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 97.47
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 97.45
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 96.93
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 96.83
d2cpqa178 Fragile X mental retardation syndrome related prot 96.75
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 96.44
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 96.21
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 96.11
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 95.1
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 93.64
d1wjwa_112 Phosphoacetylglucosamine mutase {Mouse (Mus muscul 84.86
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: RNA splicing factor 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.04  E-value=2.9e-10  Score=76.58  Aligned_cols=64  Identities=23%  Similarity=0.305  Sum_probs=52.3

Q ss_pred             ccHHHHHHhHhhhcceeeeecee--------eCCCCCCCCCCCceEEEEEeCCHHHHHHHHHHHHHHHHHHH
Q psy17590         11 LLGEALAQISEYSEAGITVRGIY--------IPPGKNPPEGERKLFLAIESTNELAVSKAKVEITRLIKEEL   74 (98)
Q Consensus        11 T~~~tl~~I~e~Tga~It~KG~y--------~ppg~~p~~ge~kLYL~Ieg~te~~V~~A~~eIk~ii~e~~   74 (98)
                      -++.|+.+|+++|||.|++||+-        ++........+.+||++|+|.+++.|++|+.+|+.+|...+
T Consensus        26 PrG~t~K~Le~eTgckI~IrGrGS~kd~~~~~~~~~~~~~~~epLHv~I~a~~~~~~~~A~~~i~~ll~~~~   97 (122)
T d1k1ga_          26 PRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGI   97 (122)
T ss_dssp             SSSHHHHHHHHHSCCEEEEEESTTSSSSSSSSCCCCCSCCSSCCEEEEEEESSHHHHHHHHHHHHHHHTTTT
T ss_pred             CCCchHHHHHHHHCCEEEEEecCCcccccccccCCCCCCCCCCCceEEEecCChhhHHHHHHHHHHHHHhcC
Confidence            36899999999999999999963        23333333356899999999999999999999999997543



>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wjwa_ d.129.2.1 (A:) Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure