Diaphorina citri psyllid: psy17594

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58

MELSTLISIKQLSSILDFITGSESSGGGEGIDYEFNVWPKADCAGTEFENGNRTWFHFGMKGGSALKVVKLNIVNLNRQVKMFSQGMAPVYRSHSTRIFMYGNHFQNTVDKVECMLLAKIMSINSPHFHFHACNFTERIMYLRDRRDGLSREGAGRVAVGKITGLIRSYTLECNYNTGRIVNVVPPSSRDPGKRSNLTLVPPKYTPALFEEMGENAQDITLALWVVFVSNLPSYIGETFRTVRLTVEKFNVIESRVLTGEQHLWQELSYSMELSTLISIKQLSSILDFITGSESSGGGEGIDYEFNVWPKADCAGTEFENGNRTWFHFGMKGGSALKVVKLNIVNLNRQVKMFSQGMAPVYRSHSTRNQWERIREKPTYSYDGSVFTLSFKHRITDTKSFTYFAFTYPYSYSELQTHLFNLDAKFPPNEQPNPDDIYYVRECVCYTLEGRRVDLLTISSHHGITNVSEPRLPHLFPEDATCRPKKFTDKKVVFLSARVHPGETPSSFVMNGVINFLLTRDDPIASLLRKMYLFKIIPMLNPDGVARGHYRTDTRGVNLNRYYTNPSPVYHPSVFAARSQ

ccccEEEEEcccEEEEcccccccccccccccccEEEEECcccccccccccccCEEEcccccccccHHHHHHHHHHHHHccccEEEECccccccccccEEEEccccccHHHHHHHHHHHHHHHccccccccccccccHHHcHHcccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHEEEcccccccccccEEEEEEEEcccccccccccccccHHHHccccccccEEEEccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEEEEEECccccEEEEEEEEcccccccccccccccccccccccccccccccccEEEEcccEEEEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHccccccccccccccEEEEEEEccccccEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHcccccHHHHHHHHccEEEEEECccccccccccccccccccccccccccccccccccEEEEccc

***STLISIKQLSSI*************EGIDYEFNVWPKADCAGTEFENGNRTWFHFGMKGGSALKVVKLNIVNLNRQVKMFSQGMAPVYRSHSTRIFMYGNHFQNTVDKVECMLLAKIMSINSPHFHFHACNFTERIMYLRDRRD****EGAGRVAVGKITGLIRSYTLECNYNTGRIVNVV**************LVPPKYTPALFEEMGENAQDITLALWVVFVSNLPSYIGETFRTVRLTVEKFNVIESRVLTGEQHLWQELSYSMELSTLISIKQLSSILDFITGSESSGGGEGIDYEFNVWPKADCAGTEFENGNRTWFHFGMKGGSALKVVKLNIVNLNRQVKMFSQGMAPVYRSHSTRNQWERIREKPTYSYDGSVFTLSFKHRITDTKSFTYFAFTYPYSYSELQTHLFNLDAKFPPNEQPNPDDIYYVRECVCYTLEGRRVDLLTISSHHGITNVSEPRLPHLFPEDATCRPKKFTDKKVVFLSARVHPGETPSSFVMNGVINFLLTRDDPIASLLRKMYLFKIIPMLNPDGVARGHYRTDTRGVNLNRYYTNPSPVYHPSVFAAR**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytosolic carboxypeptidase-like protein 5	Metallocarboxypeptidase that mediates tubulin deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins. In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains, a process catalyzed by AGTPBP1/ CCP1, AGBL1/CCP4 and AGBL4/CCP6.	confident	Q09M02
Cytosolic carboxypeptidase-like protein 5	Metallocarboxypeptidase that mediates tubulin deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins. In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains.	confident	B0JZV4
Cytosolic carboxypeptidase-like protein 5	Metallocarboxypeptidase that mediates tubulin deglutamylation. Specifically catalyzes the deglutamylation of the branching point glutamate side chains generated by post-translational glutamylation in proteins such as tubulins. In contrast, it is not able to act as a long-chain deglutamylase that shortens long polyglutamate chains.	confident	Q68EI3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004181 [MF]	metallocarboxypeptidase activity	probable	GO:0016787, GO:0003824, GO:0004180, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0015631 [MF]	tubulin binding	probable	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0035611 [BP]	protein branching point deglutamylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0035608, GO:0018200, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A37, chain A
Confidence level:very confident
Coverage over the Query: 286-426,437-461,487-578
View the alignment between query and template
View the model in PyMOL

Template: 4A37, chain A
Confidence level:very confident
Coverage over the Query: 14-90
View the alignment between query and template
View the model in PyMOL