Diaphorina citri psyllid: psy17599


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MFSSMCNIVWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDEKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENERYKGYKVNKSEEEILQQEIDRLRKEGKYPLKPVLYVFRINLWLISYQGRCSRR
ccHHHHHHHHHHHHHccHHHHHHccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcc
MFSSMCNIVWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDEKAIETFHLLSKAIEVLLDKSARAAYDSVI*******************************************************LRKEGKYPLKPVLYVFRINLWLISYQG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSSMCNIVWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDEKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRxxxxxxxxxxxxxxxxxxxxxxxxxxxxGxxxxxxxxxxxxxxxxxxxxxGKYPLKPVLYVFRINLWLISYQGRCSRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0070013 [CC]intracellular organelle lumenprobableGO:0005575, GO:0043233, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0043226, GO:0044422
GO:0016020 [CC]membraneprobableGO:0005575
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CTW, chain A
Confidence level:very confident
Coverage over the Query: 23-99
View the alignment between query and template
View the model in PyMOL
Template: 3UO3, chain A
Confidence level:confident
Coverage over the Query: 23-128,143-169
View the alignment between query and template
View the model in PyMOL