Diaphorina citri psyllid: psy17601


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60----
QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID
cHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccc
*****ES******************AQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase tricorner Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.confidentQ9NBK5
Serine/threonine-protein kinase tricorner Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.confidentQ2LZZ7
Serine/threonine-protein kinase 38-like Involved in the regulation of structural processes in differentiating and mature neuronal cells.confidentQ9Y2H1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingconfidentGO:0003674
GO:0007165 [BP]signal transductionconfidentGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005938 [CC]cell cortexconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0043232 [CC]intracellular non-membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0048814 [BP]regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043407 [BP]negative regulation of MAP kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0023057, GO:0043405, GO:0010648, GO:0023051, GO:0009892, GO:0071901, GO:0071900, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0070593 [BP]dendrite self-avoidanceprobableGO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0022416 [BP]chaeta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0070688 [CC]MLL5-L complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0035317 [BP]imaginal disc-derived wing hair organizationprobableGO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0044763, GO:0048731, GO:0022008, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0008150, GO:0048736, GO:0048737
GO:0048800 [BP]antennal morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0009791, GO:0002165, GO:0035214, GO:0009653, GO:0007275, GO:0044699, GO:0007455, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0032501, GO:0035114, GO:0008150, GO:0007469, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043332 [CC]mating projection tipprobableGO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0009524 [CC]phragmoplastprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045927 [BP]positive regulation of growthprobableGO:0048518, GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007163 [BP]establishment or maintenance of cell polarityprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0031505 [BP]fungal-type cell wall organizationprobableGO:0008150, GO:0009987, GO:0016043, GO:0071554, GO:0071555, GO:0044763, GO:0044699, GO:0045229, GO:0071840, GO:0071852
GO:0031435 [MF]mitogen-activated protein kinase kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0001411 [CC]hyphal tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0071214 [BP]cellular response to abiotic stimulusprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005934 [CC]cellular bud tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0030428 [CC]cell septumprobableGO:0005575, GO:0044464, GO:0005623
GO:0051285 [CC]cell cortex of cell tipprobableGO:0005737, GO:0060187, GO:0051286, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0000131 [CC]incipient cellular bud siteprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VD5, chain A
Confidence level:very confident
Coverage over the Query: 24-63
View the alignment between query and template
View the model in PyMOL
Template: 1L6X, chain B
Confidence level:probable
Coverage over the Query: 3-26
View the alignment between query and template
View the model in PyMOL