Psyllid ID: psy17601

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60----
Protein Sequence
QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID
Secondary Structure (PSIPRED)
cHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccc
Secondary Structure Prediction (SSPRO)
cHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHccEEEEEEcccccEEEEEcc
Coil and Loop (DISEMBL)
qakleeslkdeslSETQRQEKRQQHAQKETEFLRLkrsrlgvedfeplkvigrgafgecpkkid
Flexible Loop (DISEMBL)
qakleeslkdeslsetqrqekRQQHAQketeflrlkrsrlgvedfeplkvigrgafgecpkkid
Low Complexity Region (SEG)
QAkleeslkdeslseTQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID
Disordered region (IsUnstruct)
***************************************LGVEDFEPLKVIGRGAF********
Disordered Region (DISOPRED)
**KLEES******************AQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKK**
Disordered Region (DISEMBL)
*****************************TEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID
Disordered Region (DISPRO)
*****ESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID
Transmembrane Helix (TMHMM)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Transmembrane Helix (MEMSAT)
ooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
TM Helix, Signal Peptide (MEMSAT_SVM)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
TM Helix, Signal Peptide (Phobius)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	64	2.2.26 [Sep-21-2011]
Q9NBK5	463	Serine/threonine-protein	yes	N/A	0.906	0.125	0.862	2e-20
Q2LZZ7	458	Serine/threonine-protein	yes	N/A	0.906	0.126	0.844	2e-20
Q7TSE6	464	Serine/threonine-protein	yes	N/A	0.921	0.127	0.627	6e-15
Q9Y2H1	464	Serine/threonine-protein	yes	N/A	0.921	0.127	0.627	6e-15
Q91VJ4	465	Serine/threonine-protein	no	N/A	0.921	0.126	0.627	3e-14
A2VDV2	465	Serine/threonine-protein	no	N/A	0.921	0.126	0.627	3e-14
Q5R8M1	465	Serine/threonine-protein	yes	N/A	0.921	0.126	0.627	3e-14
Q15208	465	Serine/threonine-protein	no	N/A	0.921	0.126	0.627	3e-14
A8XJL7	472	Serine/threonine-protein	N/A	N/A	0.875	0.118	0.625	8e-13
Q2L6W9	476	Serine/threonine-protein	yes	N/A	0.875	0.117	0.625	9e-13

>sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 51/58 (87%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           AKLE  LKDESLSE QRQEKR QHAQKETE+LRLKR RLGVEDFE LKVIGRGAFGE 
Sbjct: 50  AKLEAQLKDESLSEAQRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEV 107

Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (89%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           AKLE  LKDESL+E+QRQEKR QHAQKETE+LRLKR RLGVEDFE LKVIGRGAFGE 
Sbjct: 49  AKLEAQLKDESLTESQRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEV 106

Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.

Drosophila pseudoobscura pseudoobscura (taxid: 46245)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 51/59 (86%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           Q KLE ++++E L++ +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE 
Sbjct: 46  QKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEV 104

Involved in the regulation of structural processes in differentiating and mature neuronal cells.

Mus musculus (taxid: 10090)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 51/59 (86%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           Q KLE ++++E L++ +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE 
Sbjct: 46  QKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEV 104

Involved in the regulation of structural processes in differentiating and mature neuronal cells.

Homo sapiens (taxid: 9606)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           Q KLE+ +++E L + +++ +R  HA+KETEFLRLKR+RLG+EDFE LKVIGRGAFGE 
Sbjct: 45  QKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEV 103

Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its non-phosphorylated form and inhibits autophosphorylation of MAP3K2.

Mus musculus (taxid: 10090)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=1 SV=1

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           Q KLE+ +++E L + +++ +R  HA+KETEFLRLKR+RLG+EDFE LKVIGRGAFGE 
Sbjct: 45  QKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEV 103

Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its non-phosphorylated form and inhibits autophosphorylation of MAP3K2.

Bos taurus (taxid: 9913)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=1 SV=1

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           Q KLE+ +++E L + +++ +R  HA+KETEFLRLKR+RLG+EDFE LKVIGRGAFGE 
Sbjct: 45  QKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEV 103

Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its non-phosphorylated form and inhibits autophosphorylation of MAP3K2.

Pongo abelii (taxid: 9601)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           Q KLE+ +++E L + +++ +R  HA+KETEFLRLKR+RLG+EDFE LKVIGRGAFGE 
Sbjct: 45  QKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEV 103

Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its non-phosphorylated form and inhibits autophosphorylation of MAP3K2.

Homo sapiens (taxid: 9606)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 43/56 (76%)

Query: 3   KLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           KLEE +    LS+ ++ EKR+ H  KET++LRLKR+RL V DFE LKVIGRGAFGE
Sbjct: 45  KLEEDMSARGLSDDEKDEKRKIHHSKETDYLRLKRTRLTVNDFESLKVIGRGAFGE 100

Acts with sax-2 to restrict the growth of both primary and secondary neurites. Regulates mechanosensory tiling by controlling the termination point of sensory dendrites.

Caenorhabditis briggsae (taxid: 6238)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

>sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 44/56 (78%)

Query: 3   KLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           KLEE +    LS+ +++EKR+ H  KET++LRLKR+RL V DFE LKVIGRGAFGE
Sbjct: 45  KLEEDISARGLSDEEKEEKRKIHHSKETDYLRLKRTRLTVNDFESLKVIGRGAFGE 100

Acts with sax-2 to restrict the growth of both primary and secondary neurites. Regulates mechanosensory tiling by controlling the termination point of sensory dendrites.

Caenorhabditis elegans (taxid: 6239)

EC: 2

EC: .

EC: 7

EC: .

EC: 1

EC: 1

EC: .

EC: 1

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	64
357609789	459	putative serine/threonine-protein kinase	0.890	0.124	0.964	1e-22
157107396	368	serine/threonine-protein kinase 38 (ndr2	0.906	0.157	0.913	3e-21
157124880	458	serine/threonine-protein kinase 38 (ndr2	0.921	0.128	0.898	4e-21
158294305	458	AGAP005521-PA [Anopheles gambiae str. PE	0.921	0.128	0.898	4e-21
312374501	513	hypothetical protein AND_15817 [Anophele	0.921	0.115	0.898	4e-21
380017040	539	PREDICTED: serine/threonine-protein kina	0.890	0.105	0.929	6e-21
340729211	576	PREDICTED: serine/threonine-protein kina	0.890	0.098	0.929	7e-21
383855850	594	PREDICTED: serine/threonine-protein kina	0.890	0.095	0.929	7e-21
350416834	576	PREDICTED: serine/threonine-protein kina	0.890	0.098	0.929	7e-21
328791460	585	PREDICTED: serine/threonine-protein kina	0.890	0.097	0.929	7e-21

>gi|357609789|gb|EHJ66673.1| putative serine/threonine-protein kinase 38 [Danaus plexippus]

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%)

Query: 3   KLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           KLEESLKDESLSETQ+QEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 
Sbjct: 44  KLEESLKDESLSETQKQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEV 100

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157107396|ref|XP_001649760.1| serine/threonine-protein kinase 38 (ndr2 protein kinase) [Aedes aegypti] gi|108868688|gb|EAT32913.1| AAEL014849-PA [Aedes aegypti]

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (94%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           QAKLE SLKDE+LSE+QRQEKR QHAQKETEFLRLKRSRLGVEDFE LKVIGRGAFGE
Sbjct: 43  QAKLEASLKDEALSESQRQEKRMQHAQKETEFLRLKRSRLGVEDFEALKVIGRGAFGE 100

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157124880|ref|XP_001660568.1| serine/threonine-protein kinase 38 (ndr2 protein kinase) [Aedes aegypti] gi|108873808|gb|EAT38033.1| AAEL010021-PA [Aedes aegypti]

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 55/59 (93%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           QAKLE SLKDE+LSE+QRQEKR QHAQKETEFLRLKRSRLGVEDFE LKVIGRGAFGE 
Sbjct: 43  QAKLEASLKDEALSESQRQEKRMQHAQKETEFLRLKRSRLGVEDFEALKVIGRGAFGEV 101

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158294305|ref|XP_315521.4| AGAP005521-PA [Anopheles gambiae str. PEST] gi|157015503|gb|EAA11864.5| AGAP005521-PA [Anopheles gambiae str. PEST]

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 55/59 (93%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           QAKLE SLKDE+LSE+QRQEKR QHAQKETEFLRLKRSRLGVEDFE LKVIGRGAFGE 
Sbjct: 43  QAKLEASLKDETLSESQRQEKRMQHAQKETEFLRLKRSRLGVEDFEALKVIGRGAFGEV 101

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312374501|gb|EFR22044.1| hypothetical protein AND_15817 [Anopheles darlingi]

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 55/59 (93%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEC 59
           QAKLE SLKDE+LSE+QRQEKR QHAQKETEFLRLKRSRLGVEDFE LKVIGRGAFGE 
Sbjct: 98  QAKLEASLKDETLSESQRQEKRMQHAQKETEFLRLKRSRLGVEDFEALKVIGRGAFGEV 156

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380017040|ref|XP_003692474.1| PREDICTED: serine/threonine-protein kinase tricorner-like, partial [Apis florea]

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/57 (92%), Positives = 54/57 (94%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           AKLEESLKDE LSE Q+QEKR QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE
Sbjct: 146 AKLEESLKDEGLSEQQKQEKRLQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 202

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340729211|ref|XP_003402900.1| PREDICTED: serine/threonine-protein kinase tricorner-like [Bombus terrestris]

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 53/57 (92%), Positives = 54/57 (94%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           AKLEESLKDE LSE Q+QEKR QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE
Sbjct: 156 AKLEESLKDEGLSEQQKQEKRLQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 212

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383855850|ref|XP_003703423.1| PREDICTED: serine/threonine-protein kinase tricorner-like [Megachile rotundata]

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 53/57 (92%), Positives = 54/57 (94%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           AKLEESLKDE LSE Q+QEKR QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE
Sbjct: 174 AKLEESLKDEGLSEQQKQEKRLQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 230

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350416834|ref|XP_003491126.1| PREDICTED: serine/threonine-protein kinase tricorner-like isoform 1 [Bombus impatiens]

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 53/57 (92%), Positives = 54/57 (94%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           AKLEESLKDE LSE Q+QEKR QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE
Sbjct: 156 AKLEESLKDEGLSEQQKQEKRLQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 212

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328791460|ref|XP_001120829.2| PREDICTED: serine/threonine-protein kinase tricorner [Apis mellifera]

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 53/57 (92%), Positives = 54/57 (94%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           AKLEESLKDE LSE Q+QEKR QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE
Sbjct: 165 AKLEESLKDEGLSEQQKQEKRLQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 221

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	64
UNIPROTKB|Q2LZZ7	458	trc "Serine/threonine-protein	0.671	0.093	0.883	3.3e-14
FB|FBgn0003744	463	trc "tricornered" [Drosophila	0.656	0.090	0.904	4.3e-14
UNIPROTKB|F5GY51	131	STK38L "Serine/threonine-prote	0.656	0.320	0.738	1.9e-12
UNIPROTKB|I3L0D0	89	STK38L "Serine/threonine-prote	0.656	0.471	0.738	1.9e-12
UNIPROTKB|J9PAL5	241	STK38 "Uncharacterized protein	0.656	0.174	0.738	3.9e-12
RGD|1564793	386	Stk38l "serine/threonine kinas	0.656	0.108	0.761	4.3e-12
UNIPROTKB|E1C8Z7	465	STK38 "Uncharacterized protein	0.656	0.090	0.761	1.1e-11
ZFIN|ZDB-GENE-081031-2	469	stk38b "serine/threonine kinas	0.656	0.089	0.738	1.1e-11
UNIPROTKB|A7MB32	464	STK38L "STK38L protein" [Bos t	0.656	0.090	0.738	1.4e-11
UNIPROTKB|E2R001	464	STK38L "Uncharacterized protei	0.656	0.090	0.738	1.4e-11

UNIPROTKB|Q2LZZ7 trc "Serine/threonine-protein kinase tricorner" [Drosophila pseudoobscura pseudoobscura (taxid:46245)]

 Score = 190 (71.9 bits), Expect = 3.3e-14, P = 3.3e-14
 Identities = 38/43 (88%), Positives = 40/43 (93%)

Query:    16 TQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +QRQEKR QHAQKETE+LRLKR RLGVEDFE LKVIGRGAFGE
Sbjct:    63 SQRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGE 105

GO:0004674 "protein serine/threonine kinase activity" evidence=ISS

GO:0005524 "ATP binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISS

GO:0005737 "cytoplasm" evidence=ISS

GO:0006468 "protein phosphorylation" evidence=ISS

GO:0007165 "signal transduction" evidence=ISS

GO:0007243 "intracellular protein kinase cascade" evidence=ISS

GO:0050773 "regulation of dendrite development" evidence=ISS

FB|FBgn0003744 trc "tricornered" [Drosophila melanogaster (taxid:7227)]

 Score = 189 (71.6 bits), Expect = 4.3e-14, P = 4.3e-14
 Identities = 38/42 (90%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             QRQEKR QHAQKETE+LRLKR RLGVEDFE LKVIGRGAFGE
Sbjct:    65 QRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGE 106

GO:0006468 "protein phosphorylation" evidence=IEA;ISS;NAS

GO:0005634 "nucleus" evidence=ISS;IDA;NAS

GO:0004674 "protein serine/threonine kinase activity" evidence=ISS;NAS

GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP

GO:0035317 "imaginal disc-derived wing hair organization" evidence=IMP

GO:0048800 "antennal morphogenesis" evidence=IMP

GO:0005524 "ATP binding" evidence=IEA

GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP

GO:0005737 "cytoplasm" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0005938 "cell cortex" evidence=IDA

GO:0022416 "chaeta development" evidence=IMP

GO:0007165 "signal transduction" evidence=IMP

GO:0048813 "dendrite morphogenesis" evidence=IMP

GO:0070593 "dendrite self-avoidance" evidence=IGI

UNIPROTKB|F5GY51 STK38L "Serine/threonine-protein kinase 38-like" [Homo sapiens (taxid:9606)]

 Score = 166 (63.5 bits), Expect = 1.9e-12, P = 1.9e-12
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE
Sbjct:    62 EKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGE 103

GO:0004672 "protein kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0015629 "actin cytoskeleton" evidence=IEA

GO:0051128 "regulation of cellular component organization" evidence=IEA

UNIPROTKB|I3L0D0 STK38L "Serine/threonine-protein kinase 38-like" [Homo sapiens (taxid:9606)]

 Score = 166 (63.5 bits), Expect = 1.9e-12, P = 1.9e-12
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE
Sbjct:    18 EKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGE 59

GO:0004672 "protein kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

UNIPROTKB|J9PAL5 STK38 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]

 Score = 163 (62.4 bits), Expect = 3.9e-12, P = 3.9e-12
 Identities = 31/42 (73%), Positives = 38/42 (90%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R  HA+KETEFLRLKR+RLG+EDFE LKVIGRGAFGE
Sbjct:    10 EKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGE 51

GO:0005524 "ATP binding" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

RGD|1564793 Stk38l "serine/threonine kinase 38 like" [Rattus norvegicus (taxid:10116)]

 Score = 169 (64.5 bits), Expect = 4.3e-12, P = 4.3e-12
 Identities = 32/42 (76%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +R+ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE
Sbjct:    62 ERKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGE 103

GO:0000287 "magnesium ion binding" evidence=ISO

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=ISO

GO:0005524 "ATP binding" evidence=IEA;ISO

GO:0005634 "nucleus" evidence=ISO

GO:0005737 "cytoplasm" evidence=ISO

GO:0005886 "plasma membrane" evidence=ISO

GO:0006468 "protein phosphorylation" evidence=ISO

GO:0007243 "intracellular protein kinase cascade" evidence=ISO

GO:0015629 "actin cytoskeleton" evidence=ISO

GO:0043231 "intracellular membrane-bounded organelle" evidence=ISO

GO:0051128 "regulation of cellular component organization" evidence=ISO

GO:0005730 "nucleolus" evidence=ISO

UNIPROTKB|E1C8Z7 STK38 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 167 (63.8 bits), Expect = 1.1e-11, P = 1.1e-11
 Identities = 32/42 (76%), Positives = 38/42 (90%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R  HAQKETEFLRLKR+RLG+EDFE LKVIGRGAFGE
Sbjct:    61 EKRIRRSAHAQKETEFLRLKRTRLGLEDFESLKVIGRGAFGE 102

GO:0000287 "magnesium ion binding" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0005886 "plasma membrane" evidence=IEA

GO:0007243 "intracellular protein kinase cascade" evidence=IEA

GO:0031435 "mitogen-activated protein kinase kinase kinase binding" evidence=IEA

GO:0043407 "negative regulation of MAP kinase activity" evidence=IEA

GO:0070688 "MLL5-L complex" evidence=IEA

ZFIN|ZDB-GENE-081031-2 stk38b "serine/threonine kinase 38b" [Danio rerio (taxid:7955)]

 Score = 167 (63.8 bits), Expect = 1.1e-11, P = 1.1e-11
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE
Sbjct:    61 EKRVRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGE 102

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0016740 "transferase activity" evidence=IEA

GO:0016301 "kinase activity" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

GO:0016310 "phosphorylation" evidence=IEA

UNIPROTKB|A7MB32 STK38L "STK38L protein" [Bos taurus (taxid:9913)]

 Score = 166 (63.5 bits), Expect = 1.4e-11, P = 1.4e-11
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE
Sbjct:    62 EKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGE 103

GO:0051128 "regulation of cellular component organization" evidence=IEA

GO:0015629 "actin cytoskeleton" evidence=IEA

GO:0007243 "intracellular protein kinase cascade" evidence=IEA

GO:0005886 "plasma membrane" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0000287 "magnesium ion binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

UNIPROTKB|E2R001 STK38L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]

 Score = 166 (63.5 bits), Expect = 1.4e-11, P = 1.4e-11
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query:    17 QRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +++ +R QHA+KETEFLRLKR+RLG++DFE LKVIGRGAFGE
Sbjct:    62 EKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGE 103

GO:0015629 "actin cytoskeleton" evidence=IEA

GO:0007243 "intracellular protein kinase cascade" evidence=IEA

GO:0005886 "plasma membrane" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0000287 "magnesium ion binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0051128 "regulation of cellular component organization" evidence=IEA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9Y2H1	ST38L_HUMAN	2, ., 7, ., 1, 1, ., 1	0.6271	0.9218	0.1271	yes	N/A
Q9NBK5	TRC_DROME	2, ., 7, ., 1, 1, ., 1	0.8620	0.9062	0.1252	yes	N/A
Q7TSE6	ST38L_MOUSE	2, ., 7, ., 1, 1, ., 1	0.6271	0.9218	0.1271	yes	N/A
Q2LZZ7	TRC_DROPS	2, ., 7, ., 1, 1, ., 1	0.8448	0.9062	0.1266	yes	N/A
Q2L6W9	SAX1_CAEEL	2, ., 7, ., 1, 1, ., 1	0.625	0.875	0.1176	yes	N/A
Q5R8M1	STK38_PONAB	2, ., 7, ., 1, 1, ., 1	0.6271	0.9218	0.1268	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Length	Definition	E-value
Query	64
cd05596	370	cd05596, STKc_ROCK, Catalytic domain of the Protei	9e-06
cd05599	364	cd05599, STKc_NDR_like, Catalytic domain of Nuclea	1e-05
cd05597	331	cd05597, STKc_DMPK_like, Catalytic domain of Myoto	5e-05
cd05573	350	cd05573, STKc_ROCK_NDR_like, Catalytic domain of R	1e-04
cd05622	371	cd05622, STKc_ROCK1, Catalytic domain of the Prote	6e-04
cd05623	332	cd05623, STKc_MRCK_alpha, Catalytic domain of the	0.002
cd05624	331	cd05624, STKc_MRCK_beta, Catalytic domain of the P	0.002
cd05628	363	cd05628, STKc_NDR1, Catalytic domain of the Protei	0.002

>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase

 Score = 40.5 bits (95), Expect = 9e-06
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 35 LKRSRLGVEDFEPLKVIGRGAFGE 58
          + + R+  EDF+ +KVIGRGAFGE
Sbjct: 35 ITKLRMKAEDFDVIKVIGRGAFGE 58

Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via interaction with Rho GTPases and is involved in many cellular functions including contraction, adhesion, migration, motility, proliferation, and apoptosis. The ROCK subfamily consists of two isoforms, ROCK1 and ROCK2, which may be functionally redundant in some systems, but exhibit different tissue distributions. Both isoforms are ubiquitously expressed in most tissues, but ROCK2 is more prominent in brain and skeletal muscle while ROCK1 is more pronounced in the liver, testes, and kidney. Studies in knockout mice result in different phenotypes, suggesting that the two isoforms do not compensate for each other during embryonic development. Length = 370

>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases

 Score = 40.0 bits (94), Expect = 1e-05
 Identities = 13/16 (81%), Positives = 15/16 (93%)

Query: 43 EDFEPLKVIGRGAFGE 58
          +DFE +KVIGRGAFGE
Sbjct: 1  DDFESIKVIGRGAFGE 16

Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases. Length = 364

>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases

 Score = 38.6 bits (90), Expect = 5e-05
 Identities = 14/16 (87%), Positives = 15/16 (93%)

Query: 43 EDFEPLKVIGRGAFGE 58
          +DFE LKVIGRGAFGE
Sbjct: 1  DDFEILKVIGRGAFGE 16

Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy, and cardiac conduction defects. The genetic basis for DM1 is the mutational expansion of a CTG repeat in the 3'-UTR of DMPK. DMPK is expressed in skeletal and cardiac muscles, and in central nervous tissues. The functional role of DMPK is not fully understood. It may play a role in the signal transduction and homeostasis of calcium. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKgamma is expressed in heart and skeletal muscles, unlike MRCKalpha and MRCKbeta, which are expressed ubiquitously. Length = 331

>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases

 Score = 37.3 bits (87), Expect = 1e-04
 Identities = 13/16 (81%), Positives = 15/16 (93%)

Query: 43 EDFEPLKVIGRGAFGE 58
          +DFE +KVIGRGAFGE
Sbjct: 1  DDFEVIKVIGRGAFGE 16

Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Proteins in this subfamily are involved in regulating many cellular functions including contraction, motility, division, proliferation, apoptosis, morphogenesis, and cytokinesis. Length = 350

>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1

 Score = 35.4 bits (81), Expect = 6e-04
 Identities = 14/25 (56%), Positives = 20/25 (80%)

Query: 34 RLKRSRLGVEDFEPLKVIGRGAFGE 58
          +++  R+  ED+E +KVIGRGAFGE
Sbjct: 34 KIRDLRMKAEDYEVVKVIGRGAFGE 58

Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, and kidney. It mediates signaling from Rho to the actin cytoskeleton. It is implicated in the development of cardiac fibrosis, cardiomyocyte apoptosis, and hyperglycemia. Mice deficient with ROCK1 display eyelids open at birth (EOB) and omphalocele phenotypes due to the disorganization of actin filaments in the eyelids and the umbilical ring. Length = 371

>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha

 Score = 34.3 bits (78), Expect = 0.002
 Identities = 15/16 (93%), Positives = 15/16 (93%)

Query: 43 EDFEPLKVIGRGAFGE 58
          EDFE LKVIGRGAFGE
Sbjct: 1  EDFEILKVIGRGAFGE 16

Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathway. Length = 332

>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta

 Score = 33.8 bits (77), Expect = 0.002
 Identities = 13/16 (81%), Positives = 15/16 (93%)

Query: 43 EDFEPLKVIGRGAFGE 58
          +DFE +KVIGRGAFGE
Sbjct: 1  DDFEIIKVIGRGAFGE 16

Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues. Length = 331

>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1

 Score = 33.9 bits (77), Expect = 0.002
 Identities = 15/16 (93%), Positives = 15/16 (93%)

Query: 43 EDFEPLKVIGRGAFGE 58
          EDFE LKVIGRGAFGE
Sbjct: 1  EDFESLKVIGRGAFGE 16

Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, muscle, lung and spleen. It is not an essential protein because mice deficient of NDR1 remain viable and fertile. However, these mice develop T-cell lymphomas and appear to be hypersenstive to carcinogenic treatment. NDR1 appears to act as a tumor suppressor. NDR1 is also called STK38. Length = 363

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	64
KOG0605|consensus	550		99.59
KOG0608|consensus	1034		99.38
KOG0612|consensus	1317		98.36
KOG0598|consensus	357		98.12
KOG0616|consensus	355		98.0
KOG0694|consensus	694		97.93
KOG0580|consensus	281		97.79
KOG0696|consensus	683		97.77
KOG0690|consensus	516		97.49
KOG0591|consensus	375		97.27
cd05628	363	STKc_NDR1 Catalytic domain of the Protein Serine/T	97.15
cd05599	364	STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel	97.14
cd05621	370	STKc_ROCK2 Catalytic domain of the Protein Serine/	97.12
cd05626	381	STKc_LATS2 Catalytic domain of the Protein Serine/	97.1
cd05598	376	STKc_LATS Catalytic domain of the Protein Serine/T	97.07
cd05625	382	STKc_LATS1 Catalytic domain of the Protein Serine/	97.06
KOG1035|consensus	1351		97.01
cd05088	303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	97.01
cd05596	370	STKc_ROCK Catalytic domain of the Protein Serine/T	97.01
PHA02882	294	putative serine/threonine kinase; Provisional	97.0
cd05624	331	STKc_MRCK_beta Catalytic domain of the Protein Ser	96.98
cd05627	360	STKc_NDR2 Catalytic domain of the Protein Serine/T	96.97
PLN03225	566	Serine/threonine-protein kinase SNT7; Provisional	96.97
cd05103	343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	96.96
PLN03224	507	probable serine/threonine protein kinase; Provisio	96.92
PTZ00263	329	protein kinase A catalytic subunit; Provisional	96.88
cd05102	338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	96.86
cd05114	256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	96.86
cd05597	331	STKc_DMPK_like Catalytic domain of Myotonic Dystro	96.85
cd07862	290	STKc_CDK6 Catalytic domain of the Serine/Threonine	96.84
cd05622	371	STKc_ROCK1 Catalytic domain of the Protein Serine/	96.83
cd05046	275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	96.83
PTZ00426	340	cAMP-dependent protein kinase catalytic subunit; P	96.82
cd05612	291	STKc_PRKX_like Catalytic domain of PRKX-like Prote	96.81
PTZ00284	467	protein kinase; Provisional	96.79
cd06617	283	PKc_MKK3_6 Catalytic domain of the dual-specificit	96.78
cd05623	332	STKc_MRCK_alpha Catalytic domain of the Protein Se	96.78
cd07871	288	STKc_PCTAIRE3 Catalytic domain of the Serine/Threo	96.76
cd07869	303	STKc_PFTAIRE1 Catalytic domain of the Serine/Threo	96.75
cd06649	331	PKc_MEK2 Catalytic domain of the dual-specificity	96.75
cd05108	316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	96.72
cd05629	377	STKc_NDR_like_fungal Catalytic domain of Fungal Nu	96.72
cd05048	283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	96.7
PHA03210	501	serine/threonine kinase US3; Provisional	96.69
cd05096	304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	96.69
PHA03212	391	serine/threonine kinase US3; Provisional	96.68
cd05573	350	STKc_ROCK_NDR_like Catalytic domain of ROCK- and N	96.68
KOG0585|consensus	576		96.64
cd05067	260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	96.64
cd05051	296	PTKc_DDR Catalytic domain of the Protein Tyrosine	96.63
cd05111	279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	96.62
KOG0600|consensus	560		96.61
cd05033	266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	96.58
cd07874	355	STKc_JNK3 Catalytic domain of the Serine/Threonine	96.56
cd07872	309	STKc_PCTAIRE2 Catalytic domain of the Serine/Threo	96.52
cd05600	333	STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p-	96.52
cd06620	284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	96.51
cd05109	279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	96.49
cd05090	283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	96.49
cd07876	359	STKc_JNK2 Catalytic domain of the Serine/Threonine	96.46
cd07848	287	STKc_CDKL5 Catalytic domain of the Serine/Threonin	96.46
cd06650	333	PKc_MEK1 Catalytic domain of the dual-specificity	96.45
cd07873	301	STKc_PCTAIRE1 Catalytic domain of the Serine/Threo	96.45
cd05054	337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	96.44
cd05097	295	PTKc_DDR_like Catalytic domain of Discoidin Domain	96.44
cd05072	261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	96.44
cd06622	286	PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS	96.43
cd05601	330	STKc_CRIK Catalytic domain of the Protein Serine/T	96.41
PRK09188	365	serine/threonine protein kinase; Provisional	96.39
cd07878	343	STKc_p38beta_MAPK11 Catalytic domain of the Serine	96.38
PLN00034	353	mitogen-activated protein kinase kinase; Provision	96.38
cd05104	375	PTKc_Kit Catalytic domain of the Protein Tyrosine	96.36
KOG0695|consensus	593		96.36
cd05091	283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	96.36
cd05049	280	PTKc_Trk Catalytic domain of the Protein Tyrosine	96.33
cd06619	279	PKc_MKK5 Catalytic domain of the dual-specificity	96.32
cd05089	297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	96.29
cd05110	303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	96.26
cd05032	277	PTKc_InsR_like Catalytic domain of Insulin Recepto	96.25
cd05061	288	PTKc_InsR Catalytic domain of the Protein Tyrosine	96.25
cd07845	309	STKc_CDK10 Catalytic domain of the Serine/Threonin	96.24
cd06615	308	PKc_MEK Catalytic domain of the dual-specificity P	96.23
cd07875	364	STKc_JNK1 Catalytic domain of the Serine/Threonine	96.23
cd05050	288	PTKc_Musk Catalytic domain of the Protein Tyrosine	96.23
cd05112	256	PTKc_Itk Catalytic domain of the Protein Tyrosine	96.22
cd05106	374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	96.21
PTZ00036	440	glycogen synthase kinase; Provisional	96.21
KOG0201|consensus	467		96.19
cd05066	267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	96.18
cd06646	267	STKc_MAP4K5 Catalytic domain of the Protein Serine	96.14
cd05064	266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	96.13
KOG1152|consensus	772		96.13
cd06638	286	STKc_myosinIIIA Catalytic domain of the Protein Se	96.11
cd05070	260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	96.09
cd08228	267	STKc_Nek6 Catalytic domain of the Protein Serine/T	96.04
cd05095	296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	96.02
cd06616	288	PKc_MKK4 Catalytic domain of the dual-specificity	96.02
cd05098	307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	96.01
cd08229	267	STKc_Nek7 Catalytic domain of the Protein Serine/T	96.01
KOG1164|consensus	322		95.95
PHA03209	357	serine/threonine kinase US3; Provisional	95.94
cd07844	291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	95.9
cd05036	277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	95.9
cd05059	256	PTKc_Tec_like Catalytic domain of Tec-like Protein	95.89
cd05113	256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	95.89
cd05063	268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	95.89
cd05093	288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	95.87
cd05610	669	STKc_MASTL Catalytic domain of the Protein Serine/	95.87
cd06652	265	STKc_MEKK2 Catalytic domain of the Protein Serine/	95.85
cd07837	295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	95.84
cd05039	256	PTKc_Csk_like Catalytic domain of C-terminal Src k	95.82
cd05068	261	PTKc_Frk_like Catalytic domain of Fyn-related kina	95.82
cd05092	280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	95.81
cd07866	311	STKc_BUR1 Catalytic domain of the Serine/Threonine	95.81
cd05073	260	PTKc_Hck Catalytic domain of the Protein Tyrosine	95.8
cd05034	261	PTKc_Src_like Catalytic domain of Src kinase-like	95.79
KOG0610|consensus	459		95.79
PTZ00283	496	serine/threonine protein kinase; Provisional	95.78
cd05148	261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	95.75
cd05065	269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	95.75
cd05101	304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	95.75
cd05053	293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	95.74
cd05082	256	PTKc_Csk Catalytic domain of the Protein Tyrosine	95.73
cd05062	277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	95.72
cd05105	400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	95.72
cd05100	334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	95.7
cd05057	279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	95.69
cd05038	284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	95.69
cd07865	310	STKc_CDK9 Catalytic domain of the Serine/Threonine	95.69
cd05107	401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	95.64
PTZ00266	1021	NIMA-related protein kinase; Provisional	95.61
cd07846	286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	95.6
cd06618	296	PKc_MKK7 Catalytic domain of the dual-specificity	95.6
cd07870	291	STKc_PFTAIRE2 Catalytic domain of the Serine/Threo	95.55
cd05071	262	PTKc_Src Catalytic domain of the Protein Tyrosine	95.53
cd05581	280	STKc_PDK1 Catalytic domain of the Protein Serine/T	95.52
cd06610	267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	95.52
cd05083	254	PTKc_Chk Catalytic domain of the Protein Tyrosine	95.5
KOG0659|consensus	318		95.42
cd06644	292	STKc_STK10_LOK Catalytic domain of the Protein Ser	95.42
cd05043	280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	95.41
KOG0592|consensus	604		95.4
PHA03207	392	serine/threonine kinase US3; Provisional	95.4
cd05079	284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	95.38
cd05081	284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	95.36
cd06653	264	STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina	95.35
cd05055	302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	95.34
cd07850	353	STKc_JNK Catalytic domain of the Serine/Threonine	95.33
cd07864	302	STKc_CDK12 Catalytic domain of the Serine/Threonin	95.27
cd06651	266	STKc_MEKK3 Catalytic domain of the Protein Serine/	95.27
cd07849	336	STKc_ERK1_2_like Catalytic domain of Extracellular	95.26
cd06645	267	STKc_MAP4K3 Catalytic domain of the Protein Serine	95.24
cd06605	265	PKc_MAPKK Catalytic domain of the dual-specificity	95.23
cd05094	291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	95.21
cd07843	293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	95.2
cd07847	286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	95.19
cd05574	316	STKc_phototropin_like Catalytic domain of Phototro	95.19
cd07877	345	STKc_p38alpha_MAPK14 Catalytic domain of the Serin	95.18
PLN00009	294	cyclin-dependent kinase A; Provisional	95.18
cd07880	343	STKc_p38gamma_MAPK12 Catalytic domain of the Serin	95.17
cd05609	305	STKc_MAST Catalytic domain of the Protein Serine/T	95.17
KOG0663|consensus	419		95.14
KOG0589|consensus	426		95.13
cd08224	267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	95.09
PRK13184	932	pknD serine/threonine-protein kinase; Reviewed	95.09
cd07854	342	STKc_MAPK4_6 Catalytic domain of the Serine/Threon	95.09
cd05099	314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	95.07
KOG0667|consensus	586		95.05
cd05056	270	PTKc_FAK Catalytic domain of the Protein Tyrosine	95.03
cd06623	264	PKc_MAPKK_plant_like Catalytic domain of Plant dua	95.01
cd05580	290	STKc_PKA Catalytic domain of the Protein Serine/Th	94.98
cd06625	263	STKc_MEKK3_like Catalytic domain of MAP/ERK kinase	94.97
cd06621	287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	94.97
KOG0595|consensus	429		94.95
cd06641	277	STKc_MST3 Catalytic domain of the Protein Serine/T	94.88
cd07868	317	STKc_CDK8 Catalytic domain of the Serine/Threonine	94.87
cd07858	337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	94.84
cd05052	263	PTKc_Abl Catalytic domain of the Protein Tyrosine	94.83
KOG0986|consensus	591		94.82
KOG0666|consensus	438		94.79
cd06637	272	STKc_TNIK Catalytic domain of the Protein Serine/T	94.77
cd07856	328	STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre	94.74
cd06609	274	STKc_MST3_like Catalytic domain of Mammalian Ste20	94.73
cd06608	275	STKc_myosinIII_like Catalytic domain of Class III	94.72
cd06636	282	STKc_MAP4K4_6 Catalytic domain of the Protein Seri	94.67
KOG0597|consensus	808		94.67
cd06656	297	STKc_PAK3 Catalytic domain of the Protein Serine/T	94.67
cd05080	283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	94.64
cd06613	262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	94.62
KOG0661|consensus	538		94.55
cd06639	291	STKc_myosinIIIB Catalytic domain of the Protein Se	94.54
KOG0198|consensus	313		94.54
cd06611	280	STKc_SLK_like Catalytic domain of Ste20-like kinas	94.52
cd06647	293	STKc_PAK_I Catalytic domain of the Protein Serine/	94.5
cd07833	288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	94.45
cd07855	334	STKc_ERK5 Catalytic domain of the Serine/Threonine	94.41
cd06640	277	STKc_MST4 Catalytic domain of the Protein Serine/T	94.24
cd07879	342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	94.22
KOG0583|consensus	370		94.2
cd05069	260	PTKc_Yes Catalytic domain of the Protein Tyrosine	94.14
cd07852	337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	94.13
cd06917	277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	94.09
cd06654	296	STKc_PAK1 Catalytic domain of the Protein Serine/T	94.07
PHA03211	461	serine/threonine kinase US3; Provisional	94.06
KOG0593|consensus	396		94.03
cd06612	256	STKc_MST1_2 Catalytic domain of the Protein Serine	94.02
cd06607	307	STKc_TAO Catalytic domain of the Protein Serine/Th	93.97
cd07867	317	STKc_CDC2L6 Catalytic domain of Serine/Threonine K	93.92
KOG0658|consensus	364		93.92
KOG1163|consensus	341		93.91
cd07851	343	STKc_p38 Catalytic domain of the Serine/Threonine	93.82
KOG0614|consensus	732		93.74
KOG0615|consensus	475		93.7
cd06643	282	STKc_SLK Catalytic domain of the Protein Serine/Th	93.5
KOG0594|consensus	323		93.5
cd06629	272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	93.49
KOG1151|consensus	775		93.48
KOG0576|consensus	829		93.35
PHA03390	267	pk1 serine/threonine-protein kinase 1; Provisional	93.12
KOG0611|consensus	668		92.97
cd06624	268	STKc_ASK Catalytic domain of the Protein Serine/Th	92.96
cd06642	277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	92.94
cd06635	317	STKc_TAO1 Catalytic domain of the Protein Serine/T	92.88
KOG0032|consensus	382		92.84
PTZ00024	335	cyclin-dependent protein kinase; Provisional	92.79
KOG0194|consensus	474		92.79
smart00090	237	RIO RIO-like kinase.	92.7
cd06655	296	STKc_PAK2 Catalytic domain of the Protein Serine/T	92.54
PRK10359	232	lipopolysaccharide core biosynthesis protein; Prov	92.42
KOG0193|consensus	678		92.34
PTZ00267	478	NIMA-related protein kinase; Provisional	92.06
KOG0577|consensus	948		92.05
cd05144	198	RIO2_C RIO kinase family; RIO2, C-terminal catalyt	91.62
KOG0660|consensus	359		91.46
KOG1026|consensus	774		91.3
cd06634	308	STKc_TAO2 Catalytic domain of the Protein Serine/T	91.28
cd06633	313	STKc_TAO3 Catalytic domain of the Protein Serine/T	90.84
cd06614	286	STKc_PAK Catalytic domain of the Protein Serine/Th	90.72
KOG0669|consensus	376		90.7
KOG1166|consensus	974		90.64
KOG1187|consensus	361		90.53
KOG0581|consensus	364		90.42
KOG0575|consensus	592		89.97
cd06659	297	STKc_PAK6 Catalytic domain of the Protein Serine/T	89.85
KOG0606|consensus	1205		89.78
KOG1095|consensus	1025		89.64
PLN00113	968	leucine-rich repeat receptor-like protein kinase;	89.61
KOG0671|consensus	415		89.46
cd06658	292	STKc_PAK5 Catalytic domain of the Protein Serine/T	88.64
KOG0197|consensus	468		88.57
cd06648	285	STKc_PAK_II Catalytic domain of the Protein Serine	88.43
KOG0579|consensus	1187		88.21
cd06657	292	STKc_PAK4 Catalytic domain of the Protein Serine/T	87.94
KOG0586|consensus	596		87.92
KOG4279|consensus	1226		87.91
KOG0192|consensus	362		87.89
PRK09605	535	bifunctional UGMP family protein/serine/threonine	87.39
KOG0662|consensus	292		86.96
PRK10345	210	hypothetical protein; Provisional	86.46
KOG1345|consensus	378		85.94
KOG3653|consensus	534		84.37
KOG1290|consensus	590		83.58
KOG2345|consensus	302		82.39
PRK12274	218	serine/threonine protein kinase; Provisional	82.05
PF13035	61	DUF3896: Protein of unknown function (DUF3896)	81.17
KOG0584|consensus	632		81.16
KOG0668|consensus	338		80.98
KOG2052|consensus	513		80.35

>KOG0605|consensus

Probab=99.59  E-value=2e-15  Score=110.39  Aligned_cols=62  Identities=50%  Similarity=0.754  Sum_probs=59.9

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..||+.|+..+++++++...++.+.++|++|+|++|.+++++||+++++||+||||+||||+
T Consensus       100 ~~le~~l~~~~~s~~~~~~~~~~~~~kEte~lR~~R~r~~~~DFe~Lk~IgkGAfGeVrLar  161 (550)
T KOG0605|consen  100 KELEEKLASEDVSEEEQNELLKSLLSKETEYLRLRRTRLSLDDFELLKVIGKGAFGEVRLAR  161 (550)
T ss_pred             HHHHHHHhhccccHHHHHHHHHHHhhHHHHHHHhccccCCcccchhheeeccccceeEEEEE
Confidence            57999999999999999999999999999999999999999999999999999999999996

>KOG0608|consensus

Probab=99.38  E-value=5.6e-13  Score=100.65  Aligned_cols=62  Identities=32%  Similarity=0.527  Sum_probs=60.5

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++||++|...||++..++++++.+.++|++|.|++|.++..+.|-.|+.||=|+||+|.||+
T Consensus       588 ~QLEkEM~kagLpd~~q~qMrkmL~QKESnYiRLkRaKMdKSmFvkik~iGvGAFGeV~Lv~  649 (1034)
T KOG0608|consen  588 KQLEKEMVKAGLPDIMQNQMRKMLQQKESNYIRLKRAKMDKSMFVKIKTIGVGAFGEVCLVR  649 (1034)
T ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHhhhhhHHHHHHhhccccceEEEeeecccccceeEEEe
Confidence            58999999999999999999999999999999999999999999999999999999999985

>KOG0612|consensus

Probab=98.36  E-value=3.6e-07  Score=72.27  Aligned_cols=55  Identities=36%  Similarity=0.496  Sum_probs=42.1

Q ss_pred             hcCCCCHHHHHHHHHHHHHH-HHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601          9 KDESLSETQRQEKRQQHAQK-ETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus         9 ~~~~l~~~~~~~~~~~~~~~-e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++..|.-.|..+.+.+... +...-.....+++.+||+++++||+|+||+|.||+
T Consensus        40 ~ec~~~~Lrr~k~i~~fl~~~kp~v~~v~~lrl~~~DfeilKvIGrGaFGEV~lVr   95 (1317)
T KOG0612|consen   40 DECDNSALRRDKNIAEFLNRYKPIVKKVKELRLKAEDFEILKVIGRGAFGEVALVR   95 (1317)
T ss_pred             HHhccHHHHhhhhHHHHHHHhHHHHHHHHHHhCCHHhhHHHHHhcccccceeEEEE
Confidence            45666666776666665554 44444566778999999999999999999999986

>KOG0598|consensus

Probab=98.12  E-value=9.4e-07  Score=62.74  Aligned_cols=25  Identities=48%  Similarity=0.804  Sum_probs=23.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++||+++++||+|+||+|++|+
T Consensus        21 ~~~~~dF~~lkviGkG~fGkV~~Vr   45 (357)
T KOG0598|consen   21 MVGPDDFEILKVIGKGSFGKVFQVR   45 (357)
T ss_pred             cCChhheeeeeeeeccCCceEEEEE
Confidence            5789999999999999999999986

>KOG0616|consensus

Probab=98.00  E-value=6.7e-06  Score=58.06  Aligned_cols=44  Identities=23%  Similarity=0.437  Sum_probs=30.9

Q ss_pred             HHHHHHHHHHHHHHhh----hccCCCCCCCCccccccCCccceEeeec
Q psy17601         20 EKRQQHAQKETEFLRL----KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        20 ~~~~~~~~~e~~~~r~----~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....+.+...+|...    ..+..+++||+++++||.|+||+|+||+
T Consensus        17 ~~~~~l~~~~~~~~~~~~~~~~~~~~l~dfe~~~tlGtGSFGrV~LVr   64 (355)
T KOG0616|consen   17 SVKEFLDKAREDFPKKWANTPQNPYSLQDFERLKTLGTGSFGRVHLVR   64 (355)
T ss_pred             HHHHHHHHHHHhhhhhhcCCCCCCcchhhhhheeeeccCccceEEEEE
Confidence            3344444444444432    2223789999999999999999999997

>KOG0694|consensus

Probab=97.93  E-value=4e-06  Score=63.51  Aligned_cols=26  Identities=38%  Similarity=0.677  Sum_probs=24.2

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++++||..+++||+|+||+|+||.
T Consensus       363 ~~~~l~~F~~l~vLGkGsFGkV~lae  388 (694)
T KOG0694|consen  363 GPLTLDDFRLLAVLGRGSFGKVLLAE  388 (694)
T ss_pred             CcccccceEEEEEeccCcCceEEEEE
Confidence            47899999999999999999999985

>KOG0580|consensus

Probab=97.79  E-value=1e-05  Score=55.71  Aligned_cols=27  Identities=26%  Similarity=0.450  Sum_probs=24.7

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....++||++-++||+|.||+||||+
T Consensus        16 ~~~~~l~dfeigr~LgkgkFG~vYlar   42 (281)
T KOG0580|consen   16 TKTWTLDDFEIGRPLGKGKFGNVYLAR   42 (281)
T ss_pred             ccccchhhccccccccCCccccEeEee
Confidence            346889999999999999999999997

>KOG0696|consensus

Probab=97.77  E-value=9.7e-06  Score=59.95  Aligned_cols=26  Identities=35%  Similarity=0.616  Sum_probs=23.5

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.++||+.+.+||+|+||+|+||.+
T Consensus       345 ~i~~tDFnFl~VlGKGSFGKVlLaer  370 (683)
T KOG0696|consen  345 RIKATDFNFLMVLGKGSFGKVLLAER  370 (683)
T ss_pred             ceeecccceEEEeccCccceeeeecc
Confidence            56778999999999999999999964

>KOG0690|consensus

Probab=97.49  E-value=3.7e-05  Score=55.60  Aligned_cols=27  Identities=37%  Similarity=0.711  Sum_probs=24.3

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++.++||+.+++||+|.||+|-|++
T Consensus       162 ~~kvTm~dFdfLKvLGkGTFGKVIL~r  188 (516)
T KOG0690|consen  162 KNKVTMEDFDFLKVLGKGTFGKVILCR  188 (516)
T ss_pred             cceeccchhhHHHHhcCCccceEEEEe
Confidence            446788999999999999999999986

>KOG0591|consensus

Probab=97.27  E-value=4.1e-05  Score=54.16  Aligned_cols=27  Identities=41%  Similarity=0.598  Sum_probs=24.0

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..+.||++++.||+|+||+||.|.+
T Consensus        14 ~~~~l~~y~Il~~IG~GsFg~vykv~~   40 (375)
T KOG0591|consen   14 PQKTLADYQILKKIGRGSFGEVYKVQC   40 (375)
T ss_pred             CcccHHHHHHHHHHcCCcchheEEeee
Confidence            467789999999999999999999863

>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1

Probab=97.15  E-value=0.00017  Score=49.17  Aligned_cols=22  Identities=68%  Similarity=0.989  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +||++++.||+|+||+||+|.+
T Consensus         1 ~~y~~~~~LG~G~~g~V~~~~~   22 (363)
T cd05628           1 EDFESLKVIGRGAFGEVRLVQK   22 (363)
T ss_pred             CCceEeEEEEeCCCEEEEEEEE
Confidence            5899999999999999999863

Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus

>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases

Probab=97.14  E-value=0.00017  Score=48.82  Aligned_cols=22  Identities=59%  Similarity=0.957  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lG~G~~g~V~~~~~   22 (364)
T cd05599           1 DDFESIKVIGRGAFGEVRLVQK   22 (364)
T ss_pred             CCceEEEEEEecCCEEEEEEEE
Confidence            5899999999999999999863

Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica

>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2

Probab=97.12  E-value=0.00044  Score=47.73  Aligned_cols=35  Identities=37%  Similarity=0.656  Sum_probs=27.5

Q ss_pred             HHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601         29 ETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        29 e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.............++|++++.||+|+||.||+|.
T Consensus        29 ~~~~~~~~~~~~~~~~y~~~~~lG~G~fg~Vy~~~   63 (370)
T cd05621          29 EKIVRKIRKLQMKAEDYDVVKVIGRGAFGEVQLVR   63 (370)
T ss_pred             HHHHHHHHhcCCCHHHCeEEEEEEecCCeEEEEEE
Confidence            33333445556778999999999999999999986

Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found

>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2

Probab=97.10  E-value=0.00019  Score=49.24  Aligned_cols=22  Identities=36%  Similarity=0.526  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||+||+|.+
T Consensus         1 ~~f~~~~~LG~G~~g~Vy~~~~   22 (381)
T cd05626           1 SMFVKIKTLGIGAFGEVCLACK   22 (381)
T ss_pred             CCceEEEEEeecCCEEEEEEEE
Confidence            4799999999999999999863

Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po

>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor

Probab=97.07  E-value=0.00022  Score=48.59  Aligned_cols=22  Identities=41%  Similarity=0.505  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lG~G~~g~V~~a~~   22 (376)
T cd05598           1 SMFVKIKTIGIGAFGEVCLVRK   22 (376)
T ss_pred             CCceEEEEEEeCCCeEEEEEEE
Confidence            5899999999999999999863

Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.

>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1

Probab=97.06  E-value=0.00022  Score=48.81  Aligned_cols=22  Identities=36%  Similarity=0.507  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|++
T Consensus         1 ~~f~~~~~LG~G~~g~Vy~a~~   22 (382)
T cd05625           1 SMFVKIKTLGIGAFGEVCLARK   22 (382)
T ss_pred             CCcEEEEEEEeCCCEEEEEEEE
Confidence            4699999999999999999863

Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an

>KOG1035|consensus

Probab=97.01  E-value=0.00018  Score=57.74  Aligned_cols=22  Identities=41%  Similarity=0.830  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++||+.+.+||+||||.|++|+
T Consensus       478 ~~DFEEL~lLGkGGFG~VvkVR  499 (1351)
T KOG1035|consen  478 LNDFEELELLGKGGFGSVVKVR  499 (1351)
T ss_pred             hhhhHHHHHhcCCCCceEEEEe
Confidence            4799999999999999999986

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2

Probab=97.01  E-value=0.00027  Score=46.78  Aligned_cols=26  Identities=35%  Similarity=0.463  Sum_probs=23.4

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+..++|++.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~~~lg~G~~g~V~~a~   27 (303)
T cd05088           2 PVLEWNDIKFQDVIGEGNFGQVLKAR   27 (303)
T ss_pred             CccchhhceeeeeecCCCCceEEEEE
Confidence            35778899999999999999999986

Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A

>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase

Probab=97.01  E-value=0.00036  Score=48.00  Aligned_cols=29  Identities=48%  Similarity=0.785  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....++.++|++++.||+|+||.||+|.+
T Consensus        36 ~~~~~~~~~y~~~~~lg~G~~g~Vy~~~~   64 (370)
T cd05596          36 TKLRMKAEDFDVIKVIGRGAFGEVQLVRH   64 (370)
T ss_pred             ccCCCCHHHcEEEEEEeeCCCEEEEEEEE
Confidence            44567889999999999999999999863

Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in

>PHA02882 putative serine/threonine kinase; Provisional

Probab=97.00  E-value=0.00028  Score=46.65  Aligned_cols=23  Identities=26%  Similarity=0.365  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-..|.+.+.||+|+||.||+|.
T Consensus        10 ~~~~y~i~~~LG~G~fG~Vy~~~   32 (294)
T PHA02882         10 TGKEWKIDKLIGCGGFGCVYETQ   32 (294)
T ss_pred             CCCceEEeeEEecCCCceEEEEE
Confidence            34679999999999999999985

>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta

Probab=96.98  E-value=0.00029  Score=47.45  Aligned_cols=22  Identities=59%  Similarity=0.880  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 d~y~i~~~lG~G~fg~V~~~~~   22 (331)
T cd05624           1 DDFEIIKVIGRGAFGEVAVVKM   22 (331)
T ss_pred             CCceEEEEEeeCCCeEEEEEEE
Confidence            5899999999999999999863

Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.

>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2

Probab=96.97  E-value=0.0003  Score=47.77  Aligned_cols=21  Identities=67%  Similarity=1.013  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||+|+||.||+|.
T Consensus         1 ~~f~~~~~lG~G~~g~V~~~~   21 (360)
T cd05627           1 DDFESLKVIGRGAFGEVRLVQ   21 (360)
T ss_pred             CCceEEEEEeeCCCEEEEEEE
Confidence            589999999999999999986

Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul

>PLN03225 Serine/threonine-protein kinase SNT7; Provisional

Probab=96.97  E-value=0.00038  Score=51.33  Aligned_cols=28  Identities=36%  Similarity=0.427  Sum_probs=24.5

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.....++|.+.+.||+|+||.||+|.+
T Consensus       126 ~~~~~~~~y~l~~~LG~G~FG~VYka~~  153 (566)
T PLN03225        126 RPSFKKDDFVLGKKLGEGAFGVVYKASL  153 (566)
T ss_pred             CCCCccCCeEEeEEEeeCCCeEEEEEEE
Confidence            4566789999999999999999999863

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2

Probab=96.96  E-value=0.00033  Score=47.41  Aligned_cols=23  Identities=30%  Similarity=0.429  Sum_probs=20.6

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+.+.||+|+||.||+|.
T Consensus         5 ~~~~~~~~~~lG~G~fg~V~~~~   27 (343)
T cd05103           5 PRDRLKLGKPLGRGAFGQVIEAD   27 (343)
T ss_pred             chhHhcccccccCCccceEEEEe
Confidence            44689999999999999999985

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp

>PLN03224 probable serine/threonine protein kinase; Provisional

Probab=96.92  E-value=0.0005  Score=50.53  Aligned_cols=27  Identities=30%  Similarity=0.501  Sum_probs=23.6

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+++.++|.+.+.||+|+||.||.+.
T Consensus       139 ~~r~~~d~F~i~~~LG~GgFG~VYkG~  165 (507)
T PLN03224        139 NSRWSSDDFQLRDKLGGGNFGITFEGL  165 (507)
T ss_pred             CCCccccCceEeeEeecCCCeEEEEEE
Confidence            346788999999999999999999864

>PTZ00263 protein kinase A catalytic subunit; Provisional

Probab=96.88  E-value=0.00039  Score=46.82  Aligned_cols=29  Identities=28%  Similarity=0.438  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ......+++|.+.+.||+|+||.||+|.+
T Consensus        11 ~~~~~~~~~y~~~~~lg~G~~g~V~~~~~   39 (329)
T PTZ00263         11 DTSSWKLSDFEMGETLGTGSFGRVRIAKH   39 (329)
T ss_pred             ccCCCCchheEEEEEEEecCCeEEEEEEE
Confidence            34567789999999999999999999863

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3

Probab=96.86  E-value=0.0004  Score=46.46  Aligned_cols=24  Identities=29%  Similarity=0.475  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lG~G~fg~Vy~~~   27 (338)
T cd05102           4 FPRDRLRLGKVLGHGAFGKVVEAS   27 (338)
T ss_pred             cchhHceeeeEeccCCcceEEEEE
Confidence            345789999999999999999984

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase

Probab=96.86  E-value=0.00037  Score=44.58  Aligned_cols=24  Identities=21%  Similarity=0.382  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++++|.+++.||+|+||.||+|.
T Consensus         1 ~~~~~~~~~~~lg~G~~~~vy~~~   24 (256)
T cd05114           1 INPSELTFMKELGSGQFGVVHLGK   24 (256)
T ss_pred             CCHHHcEEeeEecCCcCceEEEEE
Confidence            356889999999999999999875

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h

>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases

Probab=96.85  E-value=0.00044  Score=46.59  Aligned_cols=21  Identities=67%  Similarity=0.988  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||+|+||.||+|.
T Consensus         1 ~~y~~~~~lG~G~~g~V~~~~   21 (331)
T cd05597           1 DDFEILKVIGRGAFGEVAVVK   21 (331)
T ss_pred             CCceEEEEEEecCCeEEEEEE
Confidence            589999999999999999986

Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6

Probab=96.84  E-value=0.00059  Score=44.37  Aligned_cols=22  Identities=36%  Similarity=0.635  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|.+++.||+|+||.||+|.+
T Consensus         1 ~~Y~~~~~lg~G~~g~Vy~~~~   22 (290)
T cd07862           1 QQYECVAEIGEGAYGKVFKARD   22 (290)
T ss_pred             CCcceeeEeccCCCeEEEEEEE
Confidence            4699999999999999999863

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla

>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1

Probab=96.83  E-value=0.0011  Score=45.77  Aligned_cols=29  Identities=48%  Similarity=0.757  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....+..++|.+++.||+|+||.||+|.+
T Consensus        36 ~~~~~~~~~y~i~~~lG~G~fg~Vy~~~~   64 (371)
T cd05622          36 RDLRMKAEDYEVVKVIGRGAFGEVQLVRH   64 (371)
T ss_pred             hhcCcchhhcEEEEEEeecCCeEEEEEEE
Confidence            34567789999999999999999999863

Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4

Probab=96.83  E-value=0.00047  Score=44.40  Aligned_cols=24  Identities=25%  Similarity=0.506  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+++.||.|+||.||+|+
T Consensus         2 ~~~~~~~~~~~lg~g~~g~v~~~~   25 (275)
T cd05046           2 FPRSNLQEITTLGRGEFGEVFLAK   25 (275)
T ss_pred             CChHhceeeeeecccceeEEEEEE
Confidence            345899999999999999999986

Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s

>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional

Probab=96.82  E-value=0.00044  Score=47.13  Aligned_cols=27  Identities=26%  Similarity=0.618  Sum_probs=23.9

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+..++|.+++.||+|+||.||+|.
T Consensus        24 ~~~~~~~~y~~~~~ig~G~~g~Vy~a~   50 (340)
T PTZ00426         24 KNKMKYEDFNFIRTLGTGSFGRVILAT   50 (340)
T ss_pred             CCCCChhhcEEEEEEeecCCeEEEEEE
Confidence            346778999999999999999999985

>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases

Probab=96.81  E-value=0.00058  Score=44.97  Aligned_cols=22  Identities=36%  Similarity=0.700  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~   22 (291)
T cd05612           1 DDLERIKTVGTGTFGRVHLVRD   22 (291)
T ss_pred             CCceeeeeeecCCCeEEEEEEE
Confidence            5799999999999999999863

Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt

>PTZ00284 protein kinase; Provisional

Probab=96.79  E-value=0.00051  Score=48.56  Aligned_cols=23  Identities=30%  Similarity=0.676  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+|.+++.||+|+||.||+|.+
T Consensus       128 ~~~y~i~~~lG~G~fg~V~~a~~  150 (467)
T PTZ00284        128 TQRFKILSLLGEGTFGKVVEAWD  150 (467)
T ss_pred             CCcEEEEEEEEeccCEEEEEEEE
Confidence            46799999999999999999864

>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6

Probab=96.78  E-value=0.00059  Score=44.01  Aligned_cols=22  Identities=36%  Similarity=0.687  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +||.+++.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~ig~g~~g~v~~~~~   22 (283)
T cd06617           1 DDLEVIEELGRGAYGVVDKMRH   22 (283)
T ss_pred             CCceEEEEecccCCeEEEEEEE
Confidence            5899999999999999999863

Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs

>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha

Probab=96.78  E-value=0.00056  Score=46.00  Aligned_cols=21  Identities=71%  Similarity=1.002  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||++.
T Consensus         1 ~~y~~~~~lG~G~fg~V~~~~   21 (332)
T cd05623           1 EDFEILKVIGRGAFGEVAVVK   21 (332)
T ss_pred             CCceEEEEEEeCCCeEEEEEE
Confidence            589999999999999999985

Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw

>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase

Probab=96.76  E-value=0.00062  Score=44.68  Aligned_cols=24  Identities=21%  Similarity=0.398  Sum_probs=21.5

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~G~~g~Vy~~~~   26 (288)
T cd07871           3 KLETYVKLDKLGEGTYATVFKGRS   26 (288)
T ss_pred             ccccceEeeEEecCCCEEEEEEEE
Confidence            568899999999999999999863

Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament

>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase

Probab=96.75  E-value=0.00062  Score=44.91  Aligned_cols=23  Identities=22%  Similarity=0.512  Sum_probs=20.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|++++.||.|+||.||+|.+
T Consensus         4 ~~~y~~~~~lg~G~~g~V~~~~~   26 (303)
T cd07869           4 ADSYEKLEKLGEGSYATVYKGKS   26 (303)
T ss_pred             cccceEeeeEEecCCEEEEEEEE
Confidence            47899999999999999999864

Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2

Probab=96.75  E-value=0.00071  Score=45.49  Aligned_cols=25  Identities=32%  Similarity=0.438  Sum_probs=22.0

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|++++.||+|+||.||+|.+
T Consensus         2 l~~~~y~~~~~lg~G~~g~V~~~~~   26 (331)
T cd06649           2 LKDDDFERISELGAGNGGVVTKVQH   26 (331)
T ss_pred             CCcccceEEEeecCCCCEEEEEEEE
Confidence            4568999999999999999999863

Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor

Probab=96.72  E-value=0.00066  Score=45.09  Aligned_cols=24  Identities=42%  Similarity=0.751  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|..++.||+|+||.||+|.
T Consensus         4 ~~~~~f~~~~~lg~G~~g~Vy~~~   27 (316)
T cd05108           4 LKETEFKKIKVLGSGAFGTVYKGL   27 (316)
T ss_pred             cchhhceeeeeeecCCCceEEEEE
Confidence            456799999999999999999985

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor

>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases

Probab=96.72  E-value=0.00065  Score=46.42  Aligned_cols=21  Identities=57%  Similarity=0.906  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||.|+||.||+|.
T Consensus         1 ~~y~~~~~lG~G~~g~Vy~~~   21 (377)
T cd05629           1 EDFHTVKVIGKGAFGEVRLVQ   21 (377)
T ss_pred             CCceEeEEEeecCCEEEEEEE
Confidence            479999999999999999985

Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors

Probab=96.70  E-value=0.0006  Score=44.10  Aligned_cols=24  Identities=29%  Similarity=0.457  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++||++++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~~g~Vy~~~   25 (283)
T cd05048           2 IPLSAVRFLEELGEGAFGKVYKGE   25 (283)
T ss_pred             CChHHcchhhcccCccCCcEEEEE
Confidence            567899999999999999999875

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer

>PHA03210 serine/threonine kinase US3; Provisional

Probab=96.69  E-value=0.0007  Score=48.77  Aligned_cols=22  Identities=23%  Similarity=0.335  Sum_probs=19.7

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+++.||+|+||+||+|.
T Consensus       147 ~~~Y~ii~~LG~G~fG~Vyl~~  168 (501)
T PHA03210        147 LAHFRVIDDLPAGAFGKIFICA  168 (501)
T ss_pred             hhccEEEeEecCCCCcceEEEE
Confidence            4689999999999999999864

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1

Probab=96.69  E-value=0.00079  Score=44.32  Aligned_cols=24  Identities=21%  Similarity=0.217  Sum_probs=20.8

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~fg~V~~~~   25 (304)
T cd05096           2 FPRGHLLFKEKLGEGQFGEVHLCE   25 (304)
T ss_pred             CchhhCeeeeEecccCCeEEEEEE
Confidence            345789999999999999999985

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k

>PHA03212 serine/threonine kinase US3; Provisional

Probab=96.68  E-value=0.00088  Score=46.75  Aligned_cols=26  Identities=27%  Similarity=0.235  Sum_probs=22.8

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+...+|.+++.||+|+||.||+|+|
T Consensus        88 ~~~~~~y~~~~~lg~G~~g~V~~~~d  113 (391)
T PHA03212         88 GIEKAGFSILETFTPGAEGFAFACID  113 (391)
T ss_pred             ccccCCcEEEEEEcCCCCeEEEEEEE
Confidence            45667899999999999999999874

>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases

Probab=96.68  E-value=0.00069  Score=45.32  Aligned_cols=22  Identities=64%  Similarity=0.918  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~   22 (350)
T cd05573           1 DDFEVIKVIGRGAFGEVWLVRD   22 (350)
T ss_pred             CCceEEEEEEeCCcEEEEEEEE
Confidence            4799999999999999999864

Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the

>KOG0585|consensus

Probab=96.64  E-value=0.00082  Score=50.11  Aligned_cols=26  Identities=31%  Similarity=0.572  Sum_probs=23.7

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..+++|++++-||+|.||+|.||++
T Consensus        93 ~k~lNqy~l~~eiG~G~yGkVkLar~  118 (576)
T KOG0585|consen   93 RKQLNQYELIKEIGSGQYGKVKLARD  118 (576)
T ss_pred             ceehhheehhhhhcCCccceEEEEee
Confidence            45788999999999999999999985

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk

Probab=96.64  E-value=0.00083  Score=43.03  Aligned_cols=24  Identities=29%  Similarity=0.420  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++++.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~G~~g~v~~~~   26 (260)
T cd05067           3 VPRETLKLVKKLGAGQFGEVWMGY   26 (260)
T ss_pred             cchHHceeeeeeccCccceEEeee
Confidence            455789999999999999999986

Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors

Probab=96.63  E-value=0.001  Score=43.24  Aligned_cols=24  Identities=21%  Similarity=0.342  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...++|.+++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~~g~v~~~~   25 (296)
T cd05051           2 FPRQPLNFVEKLGEGQFGEVHLCE   25 (296)
T ss_pred             CchhhCcccccccCCCCccEEEEE
Confidence            345789999999999999999875

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3

Probab=96.62  E-value=0.00081  Score=43.87  Aligned_cols=24  Identities=38%  Similarity=0.678  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lg~G~~~~vy~~~   27 (279)
T cd05111           4 LKETELRKLKLLGSGVFGTVHKGI   27 (279)
T ss_pred             CCHhhceeccccCccCCcceEEEE
Confidence            456899999999999999999875

Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r

>KOG0600|consensus

Probab=96.61  E-value=0.00039  Score=51.80  Aligned_cols=26  Identities=31%  Similarity=0.579  Sum_probs=23.3

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....+.|+.|..||+|+||+||.|+|
T Consensus       113 ~r~~~~feki~kIGeGTyg~VYkAr~  138 (560)
T KOG0600|consen  113 PRRADSFEKIEKIGEGTYGQVYKARD  138 (560)
T ss_pred             ccchHHHHHHHHhcCcchhheeEeee
Confidence            44678999999999999999999986

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases

Probab=96.58  E-value=0.00089  Score=43.02  Aligned_cols=23  Identities=35%  Similarity=0.384  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+...||+|+||.||.|.
T Consensus         2 ~~~~~~~~~~lg~g~~g~vy~~~   24 (266)
T cd05033           2 DPSYVTIEKVIGGGEFGEVCRGR   24 (266)
T ss_pred             ChHHceeeeEecCCccceEEEEE
Confidence            46789999999999999999875

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3

Probab=96.56  E-value=0.00096  Score=45.07  Aligned_cols=24  Identities=33%  Similarity=0.439  Sum_probs=21.2

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.++|.+++.||+|+||.||+|.+
T Consensus        15 ~~~~y~~~~~lg~G~~g~V~~~~~   38 (355)
T cd07874          15 VLKRYQNLKPIGSGAQGIVCAAYD   38 (355)
T ss_pred             hhhceeEEEEeeecCCEEEEEEEe
Confidence            357899999999999999999864

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok

>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase

Probab=96.52  E-value=0.0013  Score=43.55  Aligned_cols=25  Identities=20%  Similarity=0.320  Sum_probs=21.8

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|.+++.||+|+||.||+|.+
T Consensus         3 ~~~~~y~~~~~lg~G~~g~Vy~~~~   27 (309)
T cd07872           3 GKMETYIKLEKLGEGTYATVFKGRS   27 (309)
T ss_pred             CCCCceEEEEEecccCCEEEEEEEe
Confidence            3568899999999999999999863

Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play

>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases

Probab=96.52  E-value=0.001  Score=44.53  Aligned_cols=22  Identities=27%  Similarity=0.582  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~ig~G~~g~Vy~~~~   22 (333)
T cd05600           1 KDFQILTQVGQGGYGQVFLAKK   22 (333)
T ss_pred             CCcEEEEEEeecCCeEEEEEEE
Confidence            4799999999999999999863

Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis.

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases

Probab=96.51  E-value=0.00067  Score=44.18  Aligned_cols=24  Identities=33%  Similarity=0.436  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|++++.||+|+||.||+|.
T Consensus         2 l~~~~~~~~~~ig~g~~g~v~~~~   25 (284)
T cd06620           2 LRNEDLETISDLGAGNGGSVSKVK   25 (284)
T ss_pred             ccHHHHHHHHHcCCCCCeEEEEEE
Confidence            456799999999999999999986

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2

Probab=96.49  E-value=0.0012  Score=42.75  Aligned_cols=24  Identities=42%  Similarity=0.685  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|++++.||.|+||.||.|.
T Consensus         4 l~~~~~~~~~~lg~G~~g~vy~~~   27 (279)
T cd05109           4 LKETELKKVKVLGSGAFGTVYKGI   27 (279)
T ss_pred             cchhheeeeeecCCCCCceEEEEE
Confidence            467899999999999999999885

Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1

Probab=96.49  E-value=0.0012  Score=42.93  Aligned_cols=24  Identities=25%  Similarity=0.329  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+++|++.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~vy~~~   25 (283)
T cd05090           2 LPLSAVRFMEELGECAFGKIYKGH   25 (283)
T ss_pred             CChhhceeeeeccccCCcceEEEE
Confidence            456899999999999999999974

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2

Probab=96.46  E-value=0.0011  Score=44.93  Aligned_cols=23  Identities=35%  Similarity=0.540  Sum_probs=20.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        20 ~~~y~~~~~lg~G~~g~V~~~~~   42 (359)
T cd07876          20 LKRYQQLKPIGSGAQGIVCAAFD   42 (359)
T ss_pred             hhceEEEEEeecCCCEEEEEEEE
Confidence            57899999999999999999864

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn

>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5

Probab=96.46  E-value=0.0013  Score=42.66  Aligned_cols=22  Identities=41%  Similarity=0.629  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~   22 (287)
T cd07848           1 NKFEVLGVVGEGAYGVVLKCRH   22 (287)
T ss_pred             CCceEEEEecccCCEEEEEEEE
Confidence            4799999999999999999863

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes

>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1

Probab=96.45  E-value=0.0014  Score=44.19  Aligned_cols=25  Identities=32%  Similarity=0.392  Sum_probs=21.8

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|++++.||.|+||.||+|.+
T Consensus         2 l~~~~y~~~~~lg~g~~g~V~~~~~   26 (333)
T cd06650           2 LKDDDFEKISELGAGNGGVVFKVSH   26 (333)
T ss_pred             cchhhhheeccccCCCCEEEEEEEE
Confidence            3458999999999999999999863

Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst

>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase

Probab=96.45  E-value=0.0013  Score=43.24  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=22.0

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|.+++.||.|+||.||+|.+
T Consensus         3 ~~~~~y~~~~~lg~g~~g~vy~~~~   27 (301)
T cd07873           3 GKLETYIKLDKLGEGTYATVYKGRS   27 (301)
T ss_pred             ccccceEEeeEeccCcCEEEEEEEE
Confidence            3578999999999999999999853

Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors

Probab=96.44  E-value=0.0011  Score=44.93  Aligned_cols=21  Identities=33%  Similarity=0.555  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++.+.||.|+||.||+|.
T Consensus         7 ~~~~i~~~lG~G~fg~Vy~a~   27 (337)
T cd05054           7 DRLKLGKPLGRGAFGKVIQAS   27 (337)
T ss_pred             HHhhhhcccccCcCceEEecc
Confidence            589999999999999999985

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases

Probab=96.44  E-value=0.0014  Score=42.94  Aligned_cols=23  Identities=22%  Similarity=0.309  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|++.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~lg~G~~g~v~~~~   25 (295)
T cd05097           3 PRQQLRLKEKLGEGQFGEVHLCE   25 (295)
T ss_pred             chHhCeehhccCCCCCceEEecc
Confidence            34689999999999999999875

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn

Probab=96.44  E-value=0.0011  Score=42.38  Aligned_cols=24  Identities=29%  Similarity=0.427  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~v~~~~   26 (261)
T cd05072           3 IPRESIKLVKKLGAGQFGEVWMGY   26 (261)
T ss_pred             CchHHeEEeeecCCcCCceEEEEE
Confidence            467899999999999999999985

Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa

>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases

Probab=96.43  E-value=0.0012  Score=42.84  Aligned_cols=22  Identities=27%  Similarity=0.647  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~ig~g~~g~v~~~~~   22 (286)
T cd06622           1 DEIEVLDELGKGNYGSVYKVLH   22 (286)
T ss_pred             ChhhhhhhhcccCCeEEEEEEE
Confidence            5799999999999999999863

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase

Probab=96.41  E-value=0.0013  Score=43.92  Aligned_cols=22  Identities=36%  Similarity=0.723  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~   22 (330)
T cd05601           1 KDFDVKSLVGRGHFGEVQVVRE   22 (330)
T ss_pred             CCceEEEEEEeccCEEEEEEEE
Confidence            4799999999999999999863

Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor

>PRK09188 serine/threonine protein kinase; Provisional

Probab=96.39  E-value=0.0014  Score=46.42  Aligned_cols=24  Identities=17%  Similarity=0.192  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-.++|.+...||+|+||+||+|+
T Consensus        15 ~~~~~Y~~~~~IG~G~fg~Vy~a~   38 (365)
T PRK09188         15 ALSARFVETAVLKRDVFSTVERGY   38 (365)
T ss_pred             cccCCceEccEEeecCcEEEEEEE
Confidence            345789999999999999999995

>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase

Probab=96.38  E-value=0.0014  Score=43.96  Aligned_cols=23  Identities=30%  Similarity=0.590  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.|.+++.||+|+||.||+|.+
T Consensus        14 ~~~y~~~~~lg~G~~g~V~~~~~   36 (343)
T cd07878          14 PERYQNLTPVGSGAYGSVCSAYD   36 (343)
T ss_pred             hhhhhhheecccCCCeEEEEEEE
Confidence            46899999999999999999863

Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is

>PLN00034 mitogen-activated protein kinase kinase; Provisional

Probab=96.38  E-value=0.0011  Score=44.97  Aligned_cols=25  Identities=32%  Similarity=0.425  Sum_probs=21.9

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|+.++.||.|+||.||+|.+
T Consensus        71 ~~~~~~~~~~~lg~G~~g~V~~~~~   95 (353)
T PLN00034         71 KSLSELERVNRIGSGAGGTVYKVIH   95 (353)
T ss_pred             CCHHHHhhhhhccCCCCeEEEEEEE
Confidence            4568999999999999999999863

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit

Probab=96.36  E-value=0.0012  Score=45.43  Aligned_cols=24  Identities=25%  Similarity=0.379  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus        32 ~~~~~~~~~~~LG~G~fG~V~~~~   55 (375)
T cd05104          32 FPRNRLSFGKTLGAGAFGKVVEAT   55 (375)
T ss_pred             cchHHeehhheecCCccceEEEEE
Confidence            445689999999999999999874

Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce

>KOG0695|consensus

Probab=96.36  E-value=0.0011  Score=48.39  Aligned_cols=25  Identities=40%  Similarity=0.755  Sum_probs=22.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -+.+.||..+++||+|+|.+|.||+
T Consensus       246 ~l~l~df~ll~vigrgsyakvl~~~  270 (593)
T KOG0695|consen  246 GLGLQDFDLLRVIGRGSYAKVLLVR  270 (593)
T ss_pred             ccccccceeeeeecCcchhhhhhee
Confidence            4678999999999999999999886

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2

Probab=96.36  E-value=0.00076  Score=43.69  Aligned_cols=24  Identities=17%  Similarity=0.347  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++++|.+++.||.|+||.||++.
T Consensus         2 i~~~~~~~~~~lg~G~~g~V~~~~   25 (283)
T cd05091           2 INLSTVRFMEELGEDRFGKVYKGH   25 (283)
T ss_pred             CCHHHHHHHHHhCCCCCCeEEEEE
Confidence            467789999999999999999975

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases

Probab=96.33  E-value=0.0013  Score=42.34  Aligned_cols=24  Identities=21%  Similarity=0.292  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~~~v~~~~   25 (280)
T cd05049           2 VQRDTIVLKRELGEGAFGKVFLGE   25 (280)
T ss_pred             CChHHhhHHhhccccCCceEeeee
Confidence            356789999999999999999985

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5

Probab=96.32  E-value=0.0019  Score=41.98  Aligned_cols=22  Identities=23%  Similarity=0.391  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|+++++||+|+||.||+|.+
T Consensus         1 ~~~~~~~~lg~g~~~~v~~~~~   22 (279)
T cd06619           1 QDIQYQEILGHGNGGTVYKAYH   22 (279)
T ss_pred             CcchheeeeccCCCeEEEEEEE
Confidence            4799999999999999999864

Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1

Probab=96.29  E-value=0.0022  Score=42.20  Aligned_cols=21  Identities=38%  Similarity=0.676  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.++||.|+||.||+|.
T Consensus         2 ~~~~~~~~lg~g~~g~v~~~~   22 (297)
T cd05089           2 EDIKFEDVIGEGNFGQVIRAM   22 (297)
T ss_pred             ccceeeeeecCCCcceEEEEE
Confidence            689999999999999999885

Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4

Probab=96.26  E-value=0.0018  Score=42.79  Aligned_cols=24  Identities=42%  Similarity=0.681  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|..++.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lg~G~~g~vy~~~   27 (303)
T cd05110           4 LKETELKRVKVLGSGAFGTVYKGI   27 (303)
T ss_pred             cchhhceeccccccCCCccEEEEE
Confidence            456899999999999999999985

Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases

Probab=96.25  E-value=0.0016  Score=41.90  Aligned_cols=24  Identities=25%  Similarity=0.511  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||.|+||.||++.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~v~~~~   26 (277)
T cd05032           3 LPREKITLIRELGQGSFGMVYEGL   26 (277)
T ss_pred             cchHHeeEEeEecCCCCceEEEEE
Confidence            456789999999999999999875

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor

Probab=96.25  E-value=0.0017  Score=42.46  Aligned_cols=24  Identities=25%  Similarity=0.447  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~i~~~lg~G~~g~Vy~~~   26 (288)
T cd05061           3 VSREKITLLRELGQGSFGMVYEGN   26 (288)
T ss_pred             ccHHHceeeeeecCCCCcEEEEEE
Confidence            456789999999999999999874

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta

>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10

Probab=96.24  E-value=0.0019  Score=42.57  Aligned_cols=24  Identities=38%  Similarity=0.666  Sum_probs=21.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++++|++++.||.|+||.||+|.+
T Consensus         5 ~~~~y~~~~~ig~g~~~~v~~~~~   28 (309)
T cd07845           5 SVTEFEKLNRIGEGTYGIVYRARD   28 (309)
T ss_pred             cccceeEeeeeeecCCEEEEEEEE
Confidence            578999999999999999999864

Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase

Probab=96.23  E-value=0.0024  Score=42.34  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||.|+||.||+|.
T Consensus         1 ~~~~~~~~lg~G~~g~v~~~~   21 (308)
T cd06615           1 DDFEKLGELGAGNGGVVTKVL   21 (308)
T ss_pred             CCceEEeeccCCCCeEEEEEE
Confidence            579999999999999999985

Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down

>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1

Probab=96.23  E-value=0.0019  Score=43.87  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=20.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||.|.+
T Consensus        23 ~~~y~~~~~lg~G~~g~V~~~~~   45 (364)
T cd07875          23 LKRYQNLKPIGSGAQGIVCAAYD   45 (364)
T ss_pred             hcceeEEEEeecCCCeEEEEEEE
Confidence            57999999999999999999864

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase

Probab=96.23  E-value=0.002  Score=41.93  Aligned_cols=24  Identities=29%  Similarity=0.454  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..+||++++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~v~~~~   25 (288)
T cd05050           2 YPRNNIEYVRDIGQGAFGRVFQAR   25 (288)
T ss_pred             CChHhceecccccccccccEEEEE
Confidence            356789999999999999999985

Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase

Probab=96.22  E-value=0.002  Score=40.96  Aligned_cols=23  Identities=22%  Similarity=0.283  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++|.+.+.||.|+||.||+|.
T Consensus         2 ~~~~~~~~~~ig~g~~g~v~~~~   24 (256)
T cd05112           2 HPSELTLVQEIGSGQFGLVWLGY   24 (256)
T ss_pred             ChhHeEEEeeecCcccceEEEEE
Confidence            46789999999999999999985

Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor

Probab=96.21  E-value=0.0015  Score=45.00  Aligned_cols=24  Identities=25%  Similarity=0.459  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||.||+|+
T Consensus        35 ~~~~~~~~~~~LG~G~fg~V~~~~   58 (374)
T cd05106          35 FPRDNLQFGKTLGAGAFGKVVEAT   58 (374)
T ss_pred             ccHHHceehheecCCCcccEEEEE
Confidence            345689999999999999999875

Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti

>PTZ00036 glycogen synthase kinase; Provisional

Probab=96.21  E-value=0.002  Score=45.66  Aligned_cols=25  Identities=24%  Similarity=0.376  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....+|.+++.||+|+||.||+|.+
T Consensus        63 ~~~~~y~~~~~LG~G~fg~Vy~~~~   87 (440)
T PTZ00036         63 SPNKSYKLGNIIGNGSFGVVYEAIC   87 (440)
T ss_pred             CcCCeEEEeEEEEeCCCEEEEEEEE
Confidence            3446899999999999999999863

>KOG0201|consensus

Probab=96.19  E-value=0.0022  Score=47.12  Aligned_cols=22  Identities=50%  Similarity=0.806  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..+..||+|+||+||.|+|
T Consensus        13 ~~~~~~~~IgrGsfG~Vyk~~d   34 (467)
T KOG0201|consen   13 LLYTKLELIGRGSFGEVYKAID   34 (467)
T ss_pred             cccccchhccccccceeeeeee
Confidence            5688889999999999999976

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors

Probab=96.18  E-value=0.0016  Score=41.90  Aligned_cols=23  Identities=35%  Similarity=0.406  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~g~~g~v~~~~   24 (267)
T cd05066           2 DASCIKIEKVIGAGEFGEVCSGR   24 (267)
T ss_pred             CHHHeEeeeeecccCCCceEEEE
Confidence            45689999999999999999875

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5

Probab=96.14  E-value=0.0022  Score=41.08  Aligned_cols=23  Identities=26%  Similarity=0.567  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|++++.||+|+||.||+|.
T Consensus         7 ~~~~y~~~~~lg~g~~g~vy~~~   29 (267)
T cd06646           7 PQHDYELIQRVGSGTYGDVYKAR   29 (267)
T ss_pred             chhhcchhheeecCCCeEEEEEE
Confidence            45789999999999999999986

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10

Probab=96.13  E-value=0.0022  Score=41.41  Aligned_cols=24  Identities=25%  Similarity=0.480  Sum_probs=20.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+|.+.+.||+|+||.||+|.
T Consensus         2 i~~~~~~~~~~ig~G~fg~V~~~~   25 (266)
T cd05064           2 LDNKSIKIERILGTGRFGELCRGC   25 (266)
T ss_pred             CchHHeEEeeeecccCCCeEEEEE
Confidence            345679999999999999999873

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor

>KOG1152|consensus

Probab=96.13  E-value=0.0027  Score=48.57  Aligned_cols=25  Identities=28%  Similarity=0.578  Sum_probs=22.4

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -+.+||..++.+|.|+||+|.||++
T Consensus       558 ~k~s~yttlq~lG~GAyGkV~lai~  582 (772)
T KOG1152|consen  558 KKFSDYTTLQPLGEGAYGKVNLAIH  582 (772)
T ss_pred             cccccceeeeeccccccceEEEeee
Confidence            3678999999999999999999974

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin

Probab=96.11  E-value=0.0028  Score=41.04  Aligned_cols=25  Identities=24%  Similarity=0.545  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...++|++++.||+|+||.||+|.+
T Consensus        15 ~~~~~~~~~~~lg~g~~~~vy~~~~   39 (286)
T cd06638          15 DPSDTWEIIETIGKGTYGKVFKVLN   39 (286)
T ss_pred             CcccceeeeeeeccCCCcEEEEEEE
Confidence            3557999999999999999999853

Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk

Probab=96.09  E-value=0.0024  Score=40.86  Aligned_cols=24  Identities=29%  Similarity=0.476  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++++.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~g~~~~v~~~~   26 (260)
T cd05070           3 IPRESLQLIKKLGNGQFGEVWMGT   26 (260)
T ss_pred             CchHHhhhhheeccccCceEEEEE
Confidence            345789999999999999999885

Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6

Probab=96.04  E-value=0.0031  Score=40.33  Aligned_cols=22  Identities=36%  Similarity=0.608  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++|.+.+.||.|+||.||+|.
T Consensus         1 ~~~~~i~~~l~~g~~~~v~~~~   22 (267)
T cd08228           1 LANFQIEKKIGRGQFSEVYRAT   22 (267)
T ss_pred             CcceeeeeeeccCCCeeEEEEE
Confidence            4789999999999999999985

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis. Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2

Probab=96.02  E-value=0.0029  Score=41.50  Aligned_cols=21  Identities=24%  Similarity=0.336  Sum_probs=19.0

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||.|+||.||+|.
T Consensus         5 ~~~~~~~~lg~G~~g~v~~~~   25 (296)
T cd05095           5 KRLTFKEKLGEGQFGEVHLCE   25 (296)
T ss_pred             hhceeeeeccCCCCCeEEecc
Confidence            579999999999999999874

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit

>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4

Probab=96.02  E-value=0.002  Score=41.88  Aligned_cols=23  Identities=48%  Similarity=0.758  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+||+.+..||+|+||.||++.
T Consensus         2 ~~~~~~~~~~lg~G~~g~vy~~~   24 (288)
T cd06616           2 TAEDLKDLGEIGRGAFGTVNKML   24 (288)
T ss_pred             cHHHhHHHHHhCCCCceEEEEEE
Confidence            45789999999999999999875

Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1

Probab=96.01  E-value=0.0019  Score=42.63  Aligned_cols=25  Identities=20%  Similarity=0.291  Sum_probs=21.6

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        14 ~~~~~~~~i~~~lg~G~~g~V~~~~   38 (307)
T cd05098          14 EVPRDRLVLGKPLGEGCFGQVVMAE   38 (307)
T ss_pred             eeehHHeEEeeeeccCCCeeEEEeE
Confidence            4455889999999999999999885

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7

Probab=96.01  E-value=0.0029  Score=40.45  Aligned_cols=22  Identities=36%  Similarity=0.588  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++|.+.+.||+|+||.||+|.
T Consensus         1 ~~~y~~~~~ig~g~~g~v~~~~   22 (267)
T cd08229           1 LANFRIEKKIGRGQFSEVYRAT   22 (267)
T ss_pred             CchhhhhhhhcccCCeEEEEEe
Confidence            4689999999999999999986

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.

>KOG1164|consensus

Probab=95.95  E-value=0.0032  Score=42.86  Aligned_cols=21  Identities=33%  Similarity=0.453  Sum_probs=19.6

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|.+.+.||.|+||.||+|.+
T Consensus        19 ~~~i~~~iG~G~fG~V~~v~~   39 (322)
T KOG1164|consen   19 RYKLGKKIGEGGFGAVYLVSD   39 (322)
T ss_pred             ceEEeeeccccCCceEEEEEe
Confidence            899999999999999999864

>PHA03209 serine/threonine kinase US3; Provisional

Probab=95.94  E-value=0.0035  Score=42.78  Aligned_cols=24  Identities=13%  Similarity=0.163  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+|.+++.||.|+||.||+|.+
T Consensus        64 ~~~~y~~~~~lg~G~~g~Vy~~~~   87 (357)
T PHA03209         64 ASLGYTVIKTLTPGSEGRVFVATK   87 (357)
T ss_pred             hhcCcEEEEEecCCCCeEEEEEEE
Confidence            345799999999999999999863

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases

Probab=95.90  E-value=0.0036  Score=40.70  Aligned_cols=24  Identities=21%  Similarity=0.458  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~g~~~~vy~~~~   26 (291)
T cd07844           3 KLETYKKLDKLGEGSYATVYKGRS   26 (291)
T ss_pred             CccceeEEEEEeecCCeEEEEEEE
Confidence            468999999999999999999863

Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase

Probab=95.90  E-value=0.0031  Score=40.92  Aligned_cols=24  Identities=29%  Similarity=0.595  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~vy~~~   26 (277)
T cd05036           3 VPRDSITLLRALGHGAFGEVYEGL   26 (277)
T ss_pred             CCHHHcEeeeECCCCCCCcEEEEE
Confidence            455789999999999999999885

Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases

Probab=95.89  E-value=0.0032  Score=40.29  Aligned_cols=23  Identities=26%  Similarity=0.371  Sum_probs=20.5

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~G~~~~v~~~~   24 (256)
T cd05059           2 DPSELTFLKELGSGQFGVVHLGK   24 (256)
T ss_pred             ChHHcchhhhhccCCCceEEEeE
Confidence            45689999999999999999975

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome

Probab=95.89  E-value=0.0027  Score=40.80  Aligned_cols=23  Identities=30%  Similarity=0.421  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+||.+++.||.|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~G~~~~vy~~~   24 (256)
T cd05113           2 DPKDLTFLKELGTGQFGVVKYGK   24 (256)
T ss_pred             ChHHeEEeeEecCcccceEEEEE
Confidence            56789999999999999999985

Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2

Probab=95.89  E-value=0.0029  Score=40.54  Aligned_cols=24  Identities=38%  Similarity=0.571  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|...+.||+|+||.||+|.
T Consensus         2 i~~~~~~~~~~lg~g~~g~vy~~~   25 (268)
T cd05063           2 IHPSHITKQKVIGAGEFGEVFRGI   25 (268)
T ss_pred             CChHHceEeeEecCCCCccEEEEE
Confidence            456789999999999999999885

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B

Probab=95.87  E-value=0.0035  Score=40.97  Aligned_cols=24  Identities=21%  Similarity=0.313  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++..+|.+.+.||+|+||+||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~~~~v~~~~   25 (288)
T cd05093           2 IKRHNIVLKRELGEGAFGKVFLAE   25 (288)
T ss_pred             CchHHeeeccccCCcCCeeEEeeE
Confidence            456789999999999999999875

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly

>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase

Probab=95.87  E-value=0.0035  Score=46.86  Aligned_cols=24  Identities=38%  Similarity=0.559  Sum_probs=21.5

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus         2 ~~~~y~i~~~LG~G~fg~Vy~a~~   25 (669)
T cd05610           2 SIEEFVIVKPISRGAFGKVYLGRK   25 (669)
T ss_pred             ccCCEEEEEEEecCCCeEEEEEEE
Confidence            468899999999999999999864

Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481

>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2

Probab=95.85  E-value=0.0045  Score=39.72  Aligned_cols=23  Identities=30%  Similarity=0.472  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||+|+||.||++.+
T Consensus         1 ~~~~~~~~~l~~g~~g~v~~~~~   23 (265)
T cd06652           1 PTNWRLGKLLGQGAFGRVYLCYD   23 (265)
T ss_pred             CCcceEeeEEecCCceEEEEEEE
Confidence            36899999999999999999863

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase

Probab=95.84  E-value=0.0043  Score=40.31  Aligned_cols=22  Identities=36%  Similarity=0.714  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~g~vy~~~~   22 (295)
T cd07837           1 DAYEKLEKIGEGTYGKVYKARD   22 (295)
T ss_pred             CCceEeeEecccCCeEEEEEEE
Confidence            4699999999999999999863

Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases

Probab=95.82  E-value=0.0048  Score=39.30  Aligned_cols=24  Identities=21%  Similarity=0.404  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~g~~g~v~~~~   26 (256)
T cd05039           3 INSKELKLGATIGKGEFGDVMLGD   26 (256)
T ss_pred             cChhhccceeeeecCCCceEEEEE
Confidence            456799999999999999999885

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases

Probab=95.82  E-value=0.0039  Score=39.89  Aligned_cols=24  Identities=25%  Similarity=0.515  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~~~v~~~~   26 (261)
T cd05068           3 IDRTSIQLLRKLGAGQFGEVWEGL   26 (261)
T ss_pred             cchhheeeEEEecccCCccEEEEE
Confidence            355789999999999999999875

Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A

Probab=95.81  E-value=0.0047  Score=40.20  Aligned_cols=24  Identities=25%  Similarity=0.261  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.....||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~v~~~~   25 (280)
T cd05092           2 IKRRDIVLKWELGEGAFGKVFLAE   25 (280)
T ss_pred             CChHhceeccccCCccCCeEEEeE
Confidence            566789999999999999999874

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins

Probab=95.81  E-value=0.0039  Score=40.63  Aligned_cols=23  Identities=39%  Similarity=0.647  Sum_probs=21.1

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++|.+++.||.|+||.||+|.
T Consensus         6 ~~~~y~~~~~lg~g~~~~v~~~~   28 (311)
T cd07866           6 KLRDYEILGKLGEGTFGEVYKAR   28 (311)
T ss_pred             ccccEEEEEEeccCCCEEEEEEE
Confidence            36899999999999999999986

Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase

Probab=95.80  E-value=0.0047  Score=39.62  Aligned_cols=24  Identities=29%  Similarity=0.389  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~~~vy~~~   26 (260)
T cd05073           3 IPRESLKLEKKLGAGQFGEVWMAT   26 (260)
T ss_pred             ccccceeEEeEecCccceEEEEEE
Confidence            346789999999999999999985

Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases

Probab=95.79  E-value=0.0044  Score=39.50  Aligned_cols=24  Identities=25%  Similarity=0.372  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~i~~~ig~g~~~~v~~~~   26 (261)
T cd05034           3 IPRESLKLERKLGAGQFGEVWMGT   26 (261)
T ss_pred             cchhheeeeeeeccCcceEEEEEE
Confidence            456889999999999999999875

Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t

>KOG0610|consensus

Probab=95.79  E-value=0.0023  Score=46.90  Aligned_cols=29  Identities=31%  Similarity=0.392  Sum_probs=25.3

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +...+++++|+.++.||+|.-|.||||.+
T Consensus        70 ~~~~l~l~~f~llk~LG~GdiG~VyL~~l   98 (459)
T KOG0610|consen   70 KDGSLGLRHFRLLKRLGCGDIGTVYLVEL   98 (459)
T ss_pred             CCCccCHHHHHHHHHcCCCCceeEEEEEe
Confidence            34567889999999999999999999963

>PTZ00283 serine/threonine protein kinase; Provisional

Probab=95.78  E-value=0.0043  Score=44.80  Aligned_cols=26  Identities=19%  Similarity=0.226  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +...++|.+.+.||+|+||.||+|.+
T Consensus        28 ~~~~~rY~i~~~LG~G~fG~Vy~a~~   53 (496)
T PTZ00283         28 KEQAKKYWISRVLGSGATGTVLCAKR   53 (496)
T ss_pred             cccCCCEEEEEEEecCCCEEEEEEEE
Confidence            34457999999999999999999863

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk

Probab=95.75  E-value=0.0024  Score=40.69  Aligned_cols=24  Identities=29%  Similarity=0.404  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+|.+++.||.|+||.||+|.+
T Consensus         4 ~~~~y~~~~~ig~g~~~~vy~~~~   27 (261)
T cd05148           4 PREEFTLERKLGSGYFGEVWEGLW   27 (261)
T ss_pred             cHHHHHHhhhhccCCCccEEEeEe
Confidence            346899999999999999999863

Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors

Probab=95.75  E-value=0.0037  Score=40.21  Aligned_cols=23  Identities=35%  Similarity=0.449  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.+|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~g~~g~vy~~~   24 (269)
T cd05065           2 DVSCVKIEEVIGAGEFGEVCRGR   24 (269)
T ss_pred             ChHHeEEEeEecCCCCCeEEEEE
Confidence            46788999999999999999875

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2

Probab=95.75  E-value=0.0031  Score=41.50  Aligned_cols=25  Identities=20%  Similarity=0.355  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||.|+||.||+|.
T Consensus        11 ~~~~~~~~~~~~lg~G~~g~Vy~~~   35 (304)
T cd05101          11 EFSRDKLTLGKPLGEGCFGQVVMAE   35 (304)
T ss_pred             cccHHHeeecceeeccCCceEEEEE
Confidence            4667899999999999999999884

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors

Probab=95.74  E-value=0.0033  Score=40.88  Aligned_cols=25  Identities=32%  Similarity=0.430  Sum_probs=21.6

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||++.
T Consensus         8 ~~~~~~~~~~~~ig~g~~g~v~~~~   32 (293)
T cd05053           8 ELPRDRLTLGKPLGEGAFGQVVKAE   32 (293)
T ss_pred             ccCHhHeEEeeEecccccccEEEEE
Confidence            3456789999999999999999875

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation,

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase

Probab=95.73  E-value=0.0042  Score=39.66  Aligned_cols=24  Identities=29%  Similarity=0.599  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+.+.||+|+||.||++.
T Consensus         3 ~~~~~~~~~~~lg~g~~~~v~~~~   26 (256)
T cd05082           3 LNMKELKLLQTIGKGEFGDVMLGD   26 (256)
T ss_pred             ccHHhCeeeeeecccCCCeEEEEE
Confidence            456799999999999999999874

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor

Probab=95.72  E-value=0.0038  Score=40.39  Aligned_cols=23  Identities=26%  Similarity=0.450  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|++.+.||+|+||.||+|.
T Consensus         4 ~~~~~~~~~~ig~G~~g~v~~~~   26 (277)
T cd05062           4 AREKITMSRELGQGSFGMVYEGI   26 (277)
T ss_pred             cHHHceeeeeeccccCCeEEEEE
Confidence            45789999999999999999874

Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha

Probab=95.72  E-value=0.0051  Score=43.24  Aligned_cols=25  Identities=20%  Similarity=0.421  Sum_probs=21.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..+.|.+.+.||.|+||.||.|.
T Consensus        33 ~~~~~~~~~~~~LG~G~fG~Vy~~~   57 (400)
T cd05105          33 EFPRDGLVLGRILGSGAFGKVVEGT   57 (400)
T ss_pred             eccccceehhheecCCCCceEEEEE
Confidence            4556889999999999999999874

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3

Probab=95.70  E-value=0.0036  Score=41.93  Aligned_cols=22  Identities=23%  Similarity=0.306  Sum_probs=19.5

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+|.+.+.||+|+||.||+|.
T Consensus        11 ~~~~~i~~~ig~G~~g~v~~~~   32 (334)
T cd05100          11 RTRLTLGKPLGEGCFGQVVMAE   32 (334)
T ss_pred             HhHeeecceeccccCCcEEEEE
Confidence            3578999999999999999985

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases

Probab=95.69  E-value=0.0042  Score=40.24  Aligned_cols=24  Identities=42%  Similarity=0.720  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~ig~g~~g~v~~~~   27 (279)
T cd05057           4 LKETELEKIKVLGSGAFGTVYKGV   27 (279)
T ss_pred             cCHHHcEEcceecCCCCccEEEEE
Confidence            345789999999999999999875

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=95.69  E-value=0.0058  Score=39.22  Aligned_cols=23  Identities=22%  Similarity=0.361  Sum_probs=20.2

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~ig~g~~~~v~~~~   24 (284)
T cd05038           2 EKRHLKFIKQLGEGHFGKVELCR   24 (284)
T ss_pred             chhhchhheeeccCCCeeEEEee
Confidence            34689999999999999999985

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9

Probab=95.69  E-value=0.0043  Score=40.36  Aligned_cols=24  Identities=42%  Similarity=0.650  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus        10 ~~~~y~~~~~lg~g~~~~v~~~~~   33 (310)
T cd07865          10 EVSKYEKLAKIGQGTFGEVFKARH   33 (310)
T ss_pred             hhhheEEEEEeecCCCEEEEEEEE
Confidence            357899999999999999999863

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta

Probab=95.64  E-value=0.0036  Score=44.09  Aligned_cols=24  Identities=21%  Similarity=0.429  Sum_probs=20.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus        34 ~~~~~~~~~~~lG~G~fG~Vy~~~   57 (401)
T cd05107          34 MPRDNLVLGRTLGSGAFGRVVEAT   57 (401)
T ss_pred             ecHHHeehhhhccCCCceeEEEEE
Confidence            445678889999999999999985

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D

>PTZ00266 NIMA-related protein kinase; Provisional

Probab=95.61  E-value=0.0048  Score=48.98  Aligned_cols=26  Identities=31%  Similarity=0.497  Sum_probs=22.8

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+++|.+++.||.|+||.||+|.+
T Consensus         9 e~~l~~YeIl~kLG~GgFGtVYLAkd   34 (1021)
T PTZ00266          9 ESRLNEYEVIKKIGNGRFGEVFLVKH   34 (1021)
T ss_pred             ccccCCEEEEEEEecCCCeEEEEEEE
Confidence            45568999999999999999999864

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3

Probab=95.60  E-value=0.006  Score=39.38  Aligned_cols=22  Identities=32%  Similarity=0.613  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~~~vy~~~~   22 (286)
T cd07846           1 EKYENLGLVGEGSYGMVMKCKH   22 (286)
T ss_pred             CceeEeeeeccCCCeEEEEEEE
Confidence            4689999999999999999863

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI

>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7

Probab=95.60  E-value=0.006  Score=39.99  Aligned_cols=25  Identities=32%  Similarity=0.434  Sum_probs=22.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||.|+||.||+|.
T Consensus        11 ~~~~~~~~~~~~lg~g~~~~v~~~~   35 (296)
T cd06618          11 PADLNDLENLGEIGSGTCGQVYKMR   35 (296)
T ss_pred             cCCcchheeeeEeeccCCeEEEEEE
Confidence            5678999999999999999999986

Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it

>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase

Probab=95.55  E-value=0.005  Score=40.12  Aligned_cols=22  Identities=23%  Similarity=0.477  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+++.||.|+||.||+|.
T Consensus         4 ~~~y~~~~~ig~g~~~~v~~~~   25 (291)
T cd07870           4 ATSYLNLEKLGEGSYATVYKGI   25 (291)
T ss_pred             cceeEEEEEEEecCCEEEEEEE
Confidence            4789999999999999999985

Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src

Probab=95.53  E-value=0.0051  Score=39.64  Aligned_cols=24  Identities=25%  Similarity=0.228  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+|.+.+.||.|+||.||+|.+
T Consensus         4 ~~~~~~~~~~lg~g~~~~v~~~~~   27 (262)
T cd05071           4 PRESLRLEVKLGQGCFGEVWMGTW   27 (262)
T ss_pred             ChHHeeEeeecCCCCCCcEEEEEe
Confidence            446799999999999999999853

Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo

>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1

Probab=95.52  E-value=0.0071  Score=38.64  Aligned_cols=22  Identities=32%  Similarity=0.546  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||.|+||.||.|.+
T Consensus         1 ~~y~~~~~lg~g~~~~vy~~~~   22 (280)
T cd05581           1 DDFKFGKIIGEGSFSTVVLAKE   22 (280)
T ss_pred             CCceEeeeecCCCceEEEEEEE
Confidence            4799999999999999999863

Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase

Probab=95.52  E-value=0.0073  Score=38.33  Aligned_cols=21  Identities=38%  Similarity=0.561  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++.+.||.|+||.||.|.
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~   21 (267)
T cd06610           1 DDYELIEVIGVGATAVVYAAI   21 (267)
T ss_pred             CcceeeeeecCCCCeEEEEEE
Confidence            589999999999999999885

Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase

Probab=95.50  E-value=0.0045  Score=39.50  Aligned_cols=23  Identities=22%  Similarity=0.443  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++++|.+.+.||+|+||.||++.
T Consensus         4 ~~~~~~~~~~lg~g~~g~v~~~~   26 (254)
T cd05083           4 NLQKLTLGEIIGEGEFGAVLQGE   26 (254)
T ss_pred             cHHHceeeeeeccCCCCceEecc
Confidence            56789999999999999999864

Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki

>KOG0659|consensus

Probab=95.42  E-value=0.0058  Score=42.95  Aligned_cols=22  Identities=32%  Similarity=0.649  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|..++.||.|+||.||+|+|
T Consensus         2 ~rY~~~~~lGEG~~gvVyka~d   23 (318)
T KOG0659|consen    2 DRYEKLEKLGEGTYGVVYKARD   23 (318)
T ss_pred             chhhhhhhhcCcceEEEEEEEe
Confidence            4688899999999999999986

>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase

Probab=95.42  E-value=0.006  Score=39.82  Aligned_cols=21  Identities=38%  Similarity=0.566  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++++.||.|+||.||+|.
T Consensus        12 ~~y~i~~~lg~g~~g~vy~~~   32 (292)
T cd06644          12 EVWEIIGELGDGAFGKVYKAK   32 (292)
T ss_pred             hhhhhhheecCCCCeEEEEEE
Confidence            669999999999999999985

Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)

Probab=95.41  E-value=0.0062  Score=39.35  Aligned_cols=24  Identities=17%  Similarity=0.290  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+..+||+|+||.||.|.
T Consensus         3 ~~~~~~~~~~~i~~g~~g~V~~~~   26 (280)
T cd05043           3 ISRDRVTLSDLLQEGTFGRIFYGI   26 (280)
T ss_pred             cchhheEEeeeecccCCceEEEEE
Confidence            456789999999999999999885

Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It

>KOG0592|consensus

Probab=95.40  E-value=0.0077  Score=45.43  Aligned_cols=26  Identities=19%  Similarity=0.367  Sum_probs=24.0

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..+.||.+.++||.|+|.+|++|.+
T Consensus        69 kk~~~DF~Fg~~lGeGSYStV~~A~~   94 (604)
T KOG0592|consen   69 KKTPNDFKFGKILGEGSYSTVVLARE   94 (604)
T ss_pred             cCChhhcchhheeccccceeEEEeee
Confidence            67789999999999999999999974

>PHA03207 serine/threonine kinase US3; Provisional

Probab=95.40  E-value=0.0071  Score=41.84  Aligned_cols=21  Identities=19%  Similarity=0.181  Sum_probs=19.0

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||.|+||.||+|.
T Consensus        92 ~~y~i~~~Lg~G~~g~Vy~~~  112 (392)
T PHA03207         92 MQYNILSSLTPGSEGEVFVCT  112 (392)
T ss_pred             CceEEEEeecCCCCeEEEEEE
Confidence            469999999999999999974

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=95.38  E-value=0.008  Score=39.10  Aligned_cols=20  Identities=20%  Similarity=0.385  Sum_probs=17.9

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.+++.||+|+||.||+|.
T Consensus         5 ~~~~~~~lg~g~~g~v~~~~   24 (284)
T cd05079           5 FLKRIRDLGEGHFGKVELCR   24 (284)
T ss_pred             hhhhceecCCCCceeEEEEE
Confidence            47889999999999999885

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=95.36  E-value=0.009  Score=38.67  Aligned_cols=21  Identities=19%  Similarity=0.436  Sum_probs=18.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||.|+||.||.|.
T Consensus         4 ~~~~~~~~lg~g~~g~v~~~~   24 (284)
T cd05081           4 RHLKFIQQLGKGNFGSVELCR   24 (284)
T ss_pred             ccceeeeeccCCCCceEEEEE
Confidence            478999999999999999874

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th

>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases

Probab=95.35  E-value=0.0088  Score=38.41  Aligned_cols=22  Identities=41%  Similarity=0.590  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|.+.+.||+|+||.||+|.+
T Consensus         2 ~~~~~~~~lg~g~~g~v~~~~~   23 (264)
T cd06653           2 VNWRLGKLLGRGAFGEVYLCYD   23 (264)
T ss_pred             CceeeeeeEccCCCeEEEEEEE
Confidence            5799999999999999999863

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors

Probab=95.34  E-value=0.0049  Score=40.86  Aligned_cols=25  Identities=24%  Similarity=0.403  Sum_probs=21.7

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...++|.+.+.||+|+||.||+|.
T Consensus        31 ~~~~~~~~~~~~ig~G~~g~V~~~~   55 (302)
T cd05055          31 EFPRNNLSFGKTLGAGAFGKVVEAT   55 (302)
T ss_pred             cccHHHeEEcceeeccCCeeEEEEE
Confidence            4566799999999999999999874

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept

>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase

Probab=95.33  E-value=0.0073  Score=40.85  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+|.+++.||+|+||.||+|.+
T Consensus        15 ~~~y~~~~~lg~g~~g~V~~~~~   37 (353)
T cd07850          15 LKRYQNLKPIGSGAQGIVCAAYD   37 (353)
T ss_pred             hcceEEEEEeccCCCEEEEEEEE
Confidence            46799999999999999999863

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12

Probab=95.27  E-value=0.0066  Score=39.54  Aligned_cols=24  Identities=29%  Similarity=0.537  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++|++.+.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lg~g~~g~v~~~~   27 (302)
T cd07864           4 RCVDKFDIIGQIGEGTYGQVYKAR   27 (302)
T ss_pred             hhhhhhheeeeecccCCEEEEEEE
Confidence            356899999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3

Probab=95.27  E-value=0.01  Score=38.12  Aligned_cols=22  Identities=32%  Similarity=0.502  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -+|...+.||.|+||.||+|.+
T Consensus         2 ~~~~~~~~lg~g~~g~vy~~~~   23 (266)
T cd06651           2 INWRRGKLLGQGAFGRVYLCYD   23 (266)
T ss_pred             CCccccceecCCCCEEEEEEEE
Confidence            4799999999999999999863

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases

Probab=95.26  E-value=0.007  Score=40.60  Aligned_cols=22  Identities=27%  Similarity=0.519  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||.|+||.||+|.+
T Consensus         5 ~~y~i~~~lg~G~~g~vy~~~~   26 (336)
T cd07849           5 PRYQNLSYIGEGAYGMVCSATH   26 (336)
T ss_pred             cceEEEEEEEecCCeEEEEEEE
Confidence            6899999999999999999863

Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase

>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3

Probab=95.24  E-value=0.0045  Score=39.68  Aligned_cols=25  Identities=36%  Similarity=0.591  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...++|.+.+.||+|+||.||+|.+
T Consensus         6 ~~~~~~~~~~~lg~g~~~~v~~~~~   30 (267)
T cd06645           6 NPQEDFELIQRIGSGTYGDVYKARN   30 (267)
T ss_pred             CcHHHHHHHHHhCCCCCeEEEEEEE
Confidence            3446899999999999999999863

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated

>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase

Probab=95.23  E-value=0.0077  Score=38.35  Aligned_cols=21  Identities=33%  Similarity=0.518  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|+..+.||.|+||.||+|.
T Consensus         1 ~~~~~~~~ig~g~~~~v~~~~   21 (265)
T cd06605           1 DDLEYLGELGAGNSGVVSKVL   21 (265)
T ss_pred             CcchHHHHhcCCCCeEEEEEE
Confidence            479999999999999999985

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C

Probab=95.21  E-value=0.0073  Score=39.48  Aligned_cols=24  Identities=25%  Similarity=0.347  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+|.+...||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~vy~~~   25 (291)
T cd05094           2 IKRRDIVLKRELGEGAFGKVFLAE   25 (291)
T ss_pred             CchHHeEEeeeecccCCCeEEEeE
Confidence            456789999999999999999985

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1

Probab=95.20  E-value=0.007  Score=39.43  Aligned_cols=24  Identities=29%  Similarity=0.587  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++++|++++.||.|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~g~~~~v~~~~~   26 (293)
T cd07843           3 SVDEYEKLNRIEEGTYGVVYRARD   26 (293)
T ss_pred             chhhhhhhhhhcCCCCeEEEEEEE
Confidence            357899999999999999999863

Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4

Probab=95.19  E-value=0.0095  Score=38.33  Aligned_cols=22  Identities=36%  Similarity=0.599  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|++++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~l~~g~~~~v~~~~~   22 (286)
T cd07847           1 EKYEKLSKIGEGSYGVVFKCRN   22 (286)
T ss_pred             CceeeeeeecccCCeEEEEEEE
Confidence            4689999999999999999863

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio

>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases

Probab=95.19  E-value=0.0095  Score=39.29  Aligned_cols=22  Identities=23%  Similarity=0.433  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|+.++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~ig~g~~g~vy~~~~   22 (316)
T cd05574           1 KHFKKIKLLGKGDVGRVFLVRL   22 (316)
T ss_pred             CceEEeeeecCCccEEEEEEEE
Confidence            4799999999999999999863

Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin

>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase

Probab=95.18  E-value=0.0082  Score=40.63  Aligned_cols=24  Identities=29%  Similarity=0.537  Sum_probs=20.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus        15 ~~~~y~~~~~lg~G~~g~v~~~~~   38 (345)
T cd07877          15 VPERYQNLSPVGSGAYGSVCAAFD   38 (345)
T ss_pred             ccCceEEEEEeeecCCeEEEEEEE
Confidence            347899999999999999999863

Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14

>PLN00009 cyclin-dependent kinase A; Provisional

Probab=95.18  E-value=0.011  Score=38.54  Aligned_cols=23  Identities=30%  Similarity=0.647  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|+++..||+|+||.||+|.+
T Consensus         1 ~~~y~~~~~l~~g~~~~v~~~~~   23 (294)
T PLN00009          1 MDQYEKVEKIGEGTYGVVYKARD   23 (294)
T ss_pred             CCceEEEEEecCCCCEEEEEEEe
Confidence            46899999999999999999863

>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase

Probab=95.17  E-value=0.0086  Score=40.50  Aligned_cols=22  Identities=27%  Similarity=0.616  Sum_probs=19.8

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|.+++.||.|+||.||+|.
T Consensus        14 ~~~y~~~~~lg~G~~g~V~~~~   35 (343)
T cd07880          14 PDRYRDLKQVGSGAYGTVCSAL   35 (343)
T ss_pred             ccceEEEEEeeecCCeEEEEEE
Confidence            3679999999999999999986

Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12

>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase

Probab=95.17  E-value=0.0097  Score=39.24  Aligned_cols=21  Identities=43%  Similarity=0.681  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||.|+||.||+|.
T Consensus         1 ~~y~~~~~l~~g~~~~v~~~~   21 (305)
T cd05609           1 EDFETIKLISNGAYGAVYLVR   21 (305)
T ss_pred             CCceEeeEeecCCCeeEEEEE
Confidence            479999999999999999885

Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a

>KOG0663|consensus

Probab=95.14  E-value=0.0054  Score=44.34  Aligned_cols=24  Identities=38%  Similarity=0.630  Sum_probs=22.2

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++.|+.+..|+.|+||.||-|+|
T Consensus        74 sv~efe~lnrI~EGtyGiVYRakd   97 (419)
T KOG0663|consen   74 SVEEFEKLNRIEEGTYGVVYRAKD   97 (419)
T ss_pred             cHHHHHHHhhcccCcceeEEEecc
Confidence            568999999999999999999986

>KOG0589|consensus

Probab=95.13  E-value=0.0056  Score=44.61  Aligned_cols=22  Identities=36%  Similarity=0.724  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++|+.++.||+|+||.++|++
T Consensus         3 m~~Ye~~~~iG~GafG~a~lvr   24 (426)
T KOG0589|consen    3 MDNYEVLRQVGRGAFGSALLVR   24 (426)
T ss_pred             cchhhhhhhcCccccchhhhhh
Confidence            5789999999999999999875

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7

Probab=95.09  E-value=0.012  Score=37.45  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||.|+||.||+|.
T Consensus         2 ~~y~~~~~lg~g~~~~v~~~~   22 (267)
T cd08224           2 GNFKIEKKIGKGQFSVVYKAI   22 (267)
T ss_pred             CceeeeeeeccCCceEEEEEE
Confidence            579999999999999999985

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a

>PRK13184 pknD serine/threonine-protein kinase; Reviewed

Probab=95.09  E-value=0.0095  Score=46.94  Aligned_cols=23  Identities=26%  Similarity=0.668  Sum_probs=20.4

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.+|++++.||+|+||.||+|.+
T Consensus         1 igrYeIi~~LGkGgfG~VYlA~d   23 (932)
T PRK13184          1 MQRYDIIRLIGKGGMGEVYLAYD   23 (932)
T ss_pred             CCCeEEEEEEecCCCEEEEEEEE
Confidence            36899999999999999999863

>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6

Probab=95.09  E-value=0.0099  Score=40.12  Aligned_cols=22  Identities=23%  Similarity=0.403  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|.+++.||.|+||.||+|.+
T Consensus         5 ~~y~~~~~Lg~g~~g~vy~~~~   26 (342)
T cd07854           5 SRYMDLRPLGCGSNGLVFSAVD   26 (342)
T ss_pred             cceEEEEEecCCCCEEEEEEEE
Confidence            5799999999999999999863

Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4

Probab=95.07  E-value=0.0072  Score=40.09  Aligned_cols=24  Identities=21%  Similarity=0.357  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         9 ~~~~~~~~~~~lg~G~~g~vy~~~   32 (314)
T cd05099           9 FPRDRLVLGKPLGEGCFGQVVRAE   32 (314)
T ss_pred             ccHHHeeeeeeecCCCcccEEEee
Confidence            445789999999999999999974

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>KOG0667|consensus

Probab=95.05  E-value=0.0084  Score=45.27  Aligned_cols=21  Identities=43%  Similarity=0.877  Sum_probs=18.0

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|+++.+||+|+||+|..|.|
T Consensus       187 rY~V~e~LGkGtFGQVvk~~d  207 (586)
T KOG0667|consen  187 RYEVLEVLGKGSFGQVVKAYD  207 (586)
T ss_pred             EEEEEEEecccccceeEEEEe
Confidence            457788999999999998865

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase

Probab=95.03  E-value=0.0097  Score=38.24  Aligned_cols=24  Identities=29%  Similarity=0.544  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~v~~~~   26 (270)
T cd05056           3 IQREDITLGRCIGEGQFGDVYQGV   26 (270)
T ss_pred             echhhceeeeeeCCccceeEEEEE
Confidence            345678999999999999999985

Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions

>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins

Probab=95.01  E-value=0.011  Score=37.36  Aligned_cols=22  Identities=36%  Similarity=0.530  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~i~~g~~~~v~~~~~   22 (264)
T cd06623           1 SDLERVKVLGQGSSGVVYKVRH   22 (264)
T ss_pred             CcceeeeeeeecCCeEEEEEEE
Confidence            4799999999999999999863

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of

>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase

Probab=94.98  E-value=0.011  Score=38.57  Aligned_cols=22  Identities=36%  Similarity=0.650  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.++..||.|+||.||+|.+
T Consensus         1 ~~y~~~~~ig~g~~~~vy~~~~   22 (290)
T cd05580           1 DDFEFIKTLGTGSFGRVMLVRH   22 (290)
T ss_pred             CceEEEEEeecCCCeEEEEEEE
Confidence            4789999999999999999863

Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi

>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases

Probab=94.97  E-value=0.015  Score=36.96  Aligned_cols=21  Identities=29%  Similarity=0.493  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.++||.|+||.||+|.
T Consensus         2 ~~~~~~~~lg~g~~~~vy~~~   22 (263)
T cd06625           2 TNWRRGKLLGQGAFGRVYLCY   22 (263)
T ss_pred             CcccccceecCCCceEEEEEE
Confidence            579999999999999999985

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases

Probab=94.97  E-value=0.011  Score=38.50  Aligned_cols=22  Identities=32%  Similarity=0.294  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|+.++.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~lg~g~~~~v~~~~~   22 (287)
T cd06621           1 EKIVELSRLGEGAGGSVTKCRL   22 (287)
T ss_pred             CceEEEEEeccCCceEEEEEEE
Confidence            4789999999999999999864

Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>KOG0595|consensus

Probab=94.95  E-value=0.013  Score=42.72  Aligned_cols=23  Identities=35%  Similarity=0.427  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.+|...+-||.|+||.||.|+
T Consensus         8 ~~~~y~~~~~iG~GsfavVykg~   30 (429)
T KOG0595|consen    8 VVGDYELSREIGSGSFAVVYKGR   30 (429)
T ss_pred             ccccceehhhccCcceEEEEEeE
Confidence            46899999999999999999986

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3

Probab=94.88  E-value=0.011  Score=38.31  Aligned_cols=20  Identities=50%  Similarity=0.772  Sum_probs=17.8

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      -|..++.||.|+||.||++.
T Consensus         5 ~~~~~~~ig~G~~~~vy~~~   24 (277)
T cd06641           5 LFTKLEKIGKGSFGEVFKGI   24 (277)
T ss_pred             hhhhheeEeecCCeEEEEEE
Confidence            47788999999999999985

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int

>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8

Probab=94.87  E-value=0.013  Score=38.60  Aligned_cols=16  Identities=31%  Similarity=0.468  Sum_probs=14.2

Q ss_pred             cccccCCccceEeeec
Q psy17601         48 LKVIGRGAFGECPKKI   63 (64)
Q Consensus        48 ~~~iG~G~fG~V~La~   63 (64)
                      .+.||+|+||.||+|.
T Consensus         6 ~~~lG~G~~g~Vy~~~   21 (317)
T cd07868           6 GCKVGRGTYGHVYKAK   21 (317)
T ss_pred             ccccccCCCeEEEEEE
Confidence            4679999999999986

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants

Probab=94.84  E-value=0.014  Score=39.27  Aligned_cols=22  Identities=36%  Similarity=0.688  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|.+++.||+|+||.||+|.+
T Consensus         5 ~~y~~~~~lg~G~~~~vy~~~~   26 (337)
T cd07858           5 TKYVPIKPIGRGAYGIVCSAKN   26 (337)
T ss_pred             cceeEEEEeccCCCeEEEEEEe
Confidence            4689999999999999999863

Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase

Probab=94.83  E-value=0.0098  Score=38.17  Aligned_cols=24  Identities=21%  Similarity=0.419  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+|.+.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~g~~~~v~~~~   26 (263)
T cd05052           3 MERTDITMKHKLGGGQYGEVYEGV   26 (263)
T ss_pred             CchHHeEEeeecCCcccceEEEEE
Confidence            345789999999999999999986

Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays

>KOG0986|consensus

Probab=94.82  E-value=0.013  Score=43.90  Aligned_cols=26  Identities=27%  Similarity=0.498  Sum_probs=22.7

Q ss_pred             ccCCCCCCCCccccccCCccceEeee
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La   62 (64)
                      ...+..++|..-++||+|+||+|+-+
T Consensus       179 ~qpvt~n~F~~~RvlGkGGFGEV~ac  204 (591)
T KOG0986|consen  179 LQPVTKNTFRVYRVLGKGGFGEVCAC  204 (591)
T ss_pred             hhhccccceeeeEEEecccccceeEE
Confidence            35678899999999999999999854

>KOG0666|consensus

Probab=94.79  E-value=0.011  Score=42.72  Aligned_cols=22  Identities=32%  Similarity=0.696  Sum_probs=19.9

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..|+.+.-||+|+||.||+|.
T Consensus        23 l~~ye~ig~Ig~GTYG~VykA~   44 (438)
T KOG0666|consen   23 LFEYEGIGKIGRGTYGKVYKAV   44 (438)
T ss_pred             HHHhhccceecccccceeeEee
Confidence            4679999999999999999984

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase

Probab=94.77  E-value=0.0096  Score=38.13  Aligned_cols=21  Identities=29%  Similarity=0.567  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|.+.+.||+|+||.||+|.
T Consensus         6 ~~y~~~~~lg~g~~g~vy~~~   26 (272)
T cd06637           6 GIFELVELVGNGTYGQVYKGR   26 (272)
T ss_pred             hhhhHHHheeecCCeEEEEEE
Confidence            458889999999999999885

Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ

>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1

Probab=94.74  E-value=0.013  Score=39.40  Aligned_cols=23  Identities=30%  Similarity=0.486  Sum_probs=20.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||.|+||.||+|.+
T Consensus         9 ~~~y~~~~~ig~g~~g~v~~~~~   31 (328)
T cd07856           9 TNRYVDLQPVGMGAFGLVCSARD   31 (328)
T ss_pred             ccceEEEEeecccCCeEEEEEEE
Confidence            46799999999999999999863

Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases

Probab=94.73  E-value=0.013  Score=37.67  Aligned_cols=22  Identities=55%  Similarity=0.848  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~   22 (274)
T cd06609           1 ELFTLLECIGKGSFGEVYKAID   22 (274)
T ss_pred             ChhhhhhhhcCCCCeEEEEEEE
Confidence            4789999999999999999863

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases

Probab=94.72  E-value=0.015  Score=36.91  Aligned_cols=23  Identities=35%  Similarity=0.564  Sum_probs=20.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|++++.||.|+||.||+|.+
T Consensus         5 ~~~y~~~~~l~~g~~~~v~~~~~   27 (275)
T cd06608           5 TGIFELVEVIGEGTYGKVYKARH   27 (275)
T ss_pred             hhheeheeeecCCCCeEEEEEEE
Confidence            47899999999999999999863

Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I

>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6

Probab=94.67  E-value=0.014  Score=37.80  Aligned_cols=24  Identities=29%  Similarity=0.504  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....|++.+.||.|+||.||+|.+
T Consensus        14 ~~~~~~~~~~lg~g~~~~v~~~~~   37 (282)
T cd06636          14 PAGIFELVEVVGNGTYGQVYKGRH   37 (282)
T ss_pred             hhhhhhhheeeccCCCeEEEEEEE
Confidence            447899999999999999999863

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea

>KOG0597|consensus

Probab=94.67  E-value=0.013  Score=44.96  Aligned_cols=23  Identities=30%  Similarity=0.603  Sum_probs=20.4

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+...||+|+||.||.+++
T Consensus         1 me~yhv~e~iG~Gsfg~VYKgrr   23 (808)
T KOG0597|consen    1 MEQYHVYEMIGEGSFGRVYKGRR   23 (808)
T ss_pred             CcchhHHHHhcCCccceeeeccc
Confidence            36899999999999999999874

>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3

Probab=94.67  E-value=0.014  Score=38.43  Aligned_cols=21  Identities=29%  Similarity=0.520  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||.|+||.||+|.
T Consensus        19 ~~y~~~~~lg~g~~g~v~~~~   39 (297)
T cd06656          19 KKYTRFEKIGQGASGTVYTAI   39 (297)
T ss_pred             hhceeeeeeccCCCeEEEEEE
Confidence            789999999999999999985

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=94.64  E-value=0.018  Score=37.31  Aligned_cols=18  Identities=28%  Similarity=0.706  Sum_probs=16.1

Q ss_pred             CCccccccCCccceEeee
Q psy17601         45 FEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La   62 (64)
                      |.+++.||+|+||.||++
T Consensus         6 ~~~~~~lg~g~~g~v~~~   23 (283)
T cd05080           6 LKKIRVLGEGHFGKVSLY   23 (283)
T ss_pred             ceeceecccCCCcEEEEe
Confidence            488999999999999875

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases

Probab=94.62  E-value=0.016  Score=36.68  Aligned_cols=21  Identities=38%  Similarity=0.735  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~l~~g~~~~v~~~~   23 (262)
T cd06613           3 EDYELIQRIGSGTYGDVYKAR   23 (262)
T ss_pred             cceEEEEEecCCCceEEEEeE
Confidence            689999999999999999986

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ

>KOG0661|consensus

Probab=94.55  E-value=0.0085  Score=44.68  Aligned_cols=23  Identities=17%  Similarity=0.410  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+.|.+++-||.|+||.||||.
T Consensus         8 ~m~RY~~i~klGDGTfGsV~la~   30 (538)
T KOG0661|consen    8 FMDRYTVIRKLGDGTFGSVYLAK   30 (538)
T ss_pred             HHHHHHHHHHhcCCcceeEEEee
Confidence            34678999999999999999985

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin

Probab=94.54  E-value=0.019  Score=37.40  Aligned_cols=22  Identities=27%  Similarity=0.644  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.++..||.|+||.||+|.
T Consensus        21 ~~~y~~~~~l~~g~~~~vy~~~   42 (291)
T cd06639          21 TDTWEIIETIGKGTYGKVYKVT   42 (291)
T ss_pred             CCCeEEEEEeecCCCeEEEEEE
Confidence            5789999999999999999985

Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre

>KOG0198|consensus

Probab=94.54  E-value=0.018  Score=40.35  Aligned_cols=22  Identities=27%  Similarity=0.587  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++...+.||+|+||.|+++.
T Consensus        16 ~~~~~~~~~lG~Gs~G~V~l~~   37 (313)
T KOG0198|consen   16 ISNWSKGKLLGRGSFGSVYLAT   37 (313)
T ss_pred             cchhhhhccccCccceEEEEEE
Confidence            4568889999999999999985

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases

Probab=94.52  E-value=0.01  Score=38.31  Aligned_cols=21  Identities=33%  Similarity=0.540  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||.|+||.||+|.
T Consensus         5 ~~~~i~~~l~~g~~~~v~~~~   25 (280)
T cd06611           5 DIWEIIGELGDGAFGKVYKAQ   25 (280)
T ss_pred             hHHHHHHHhcCCCCceEEEEE
Confidence            679999999999999999985

Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti

>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase

Probab=94.50  E-value=0.018  Score=37.89  Aligned_cols=22  Identities=27%  Similarity=0.471  Sum_probs=20.0

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|.+++.||.|+||.||++.
T Consensus        18 ~~~~~~~~~lg~g~~g~v~~~~   39 (293)
T cd06647          18 KKKYTRFEKIGQGASGTVYTAI   39 (293)
T ss_pred             hhhceeeeEecCCCCeEEEEEE
Confidence            4689999999999999999985

Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases

Probab=94.45  E-value=0.02  Score=36.89  Aligned_cols=22  Identities=36%  Similarity=0.628  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~i~~g~~~~v~~~~~   22 (288)
T cd07833           1 NKYEVLGVVGEGAYGVVLKCRN   22 (288)
T ss_pred             CceeEEEEecccCCeeEEEEEe
Confidence            3689999999999999999863

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5

Probab=94.41  E-value=0.019  Score=38.46  Aligned_cols=22  Identities=36%  Similarity=0.759  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         5 ~~y~~~~~lg~g~~g~v~~~~~   26 (334)
T cd07855           5 SRYKPIENIGSGAYGVVCSAID   26 (334)
T ss_pred             hceeeeeeeecCCCeEEEEEEE
Confidence            6899999999999999998853

Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4

Probab=94.24  E-value=0.017  Score=37.42  Aligned_cols=22  Identities=55%  Similarity=0.822  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..++.||.|+||.||+|.+
T Consensus         4 ~~y~~~~~lg~g~~~~vy~~~~   25 (277)
T cd06640           4 ELFTKLERIGKGSFGEVFKGID   25 (277)
T ss_pred             HhhhhhhhcccCCCeEEEEEEE
Confidence            4688999999999999999863

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase

Probab=94.22  E-value=0.021  Score=38.51  Aligned_cols=22  Identities=41%  Similarity=0.759  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|.+...||.|+||.||+|.+
T Consensus        15 ~~y~~~~~ig~g~~g~v~~~~~   36 (342)
T cd07879          15 ERYTSLKQVGSGAYGSVCSAID   36 (342)
T ss_pred             cceEEEEEeeecCCeEEEEEEe
Confidence            5799999999999999999863

Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13

>KOG0583|consensus

Probab=94.20  E-value=0.026  Score=39.86  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....|.+.+.||.|+||+|++|.
T Consensus        14 ~~~g~y~~~~~lG~GsfgkV~~a~   37 (370)
T KOG0583|consen   14 LSIGKYELGRTLGSGSFGKVKLAK   37 (370)
T ss_pred             cccCceeeeeeecCCCCeeEEEee
Confidence            456789999999999999999985

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes

Probab=94.14  E-value=0.02  Score=36.70  Aligned_cols=23  Identities=26%  Similarity=0.296  Sum_probs=20.0

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+...||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~ig~g~~~~v~~~~   26 (260)
T cd05069           4 PRESLRLDVKLGQGCFGEVWMGT   26 (260)
T ss_pred             ChHHeeeeeeecCcCCCeEEEEE
Confidence            44678899999999999999985

Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15

Probab=94.13  E-value=0.016  Score=38.81  Aligned_cols=23  Identities=39%  Similarity=0.713  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||.|+||.||+|.+
T Consensus         6 ~~~y~~~~~lg~g~~~~v~~~~~   28 (337)
T cd07852           6 LRKYEILQKLGKGAYGIVWKAID   28 (337)
T ss_pred             hhHHHHhHhhcCCCCeeEEEEEE
Confidence            46899999999999999999864

Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases

Probab=94.09  E-value=0.023  Score=36.57  Aligned_cols=20  Identities=35%  Similarity=0.688  Sum_probs=18.2

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|+.++.||.|+||.||+|.
T Consensus         2 ~y~~~~~l~~g~~g~v~~~~   21 (277)
T cd06917           2 LYQRLELIGRGAYGAVYRGK   21 (277)
T ss_pred             hhhhhhheeccCCceEEEEE
Confidence            58889999999999999986

Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1

Probab=94.07  E-value=0.026  Score=37.20  Aligned_cols=22  Identities=23%  Similarity=0.448  Sum_probs=19.9

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+|.+++.||.|+||.||++.
T Consensus        19 ~~~y~~~~~lg~g~~~~v~~~~   40 (296)
T cd06654          19 KKKYTRFEKIGQGASGTVYTAM   40 (296)
T ss_pred             ccceeeEEEecCCCCeEEEEEE
Confidence            3689999999999999999986

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding

>PHA03211 serine/threonine kinase US3; Provisional

Probab=94.06  E-value=0.024  Score=40.90  Aligned_cols=23  Identities=13%  Similarity=0.055  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...|.+.+.||+|+||.||+|.+
T Consensus       168 ~~gy~i~~~Lg~G~~G~Vy~a~~  190 (461)
T PHA03211        168 GLGFAIHRALTPGSEGCVFESSH  190 (461)
T ss_pred             cCCeEEEEEEccCCCeEEEEEEE
Confidence            34799999999999999999864

>KOG0593|consensus

Probab=94.03  E-value=0.024  Score=40.75  Aligned_cols=23  Identities=30%  Similarity=0.586  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++.|+.+..+|.||||.||.++.
T Consensus         1 MekYE~LgkvGEGSYGvV~KCrn   23 (396)
T KOG0593|consen    1 MEKYEKLGKVGEGSYGVVMKCRN   23 (396)
T ss_pred             CcHHhhhhccccCcceEEEEecc
Confidence            35799999999999999999863

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2

Probab=94.02  E-value=0.027  Score=35.57  Aligned_cols=21  Identities=38%  Similarity=0.705  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++.+.||.|+||.||+|.
T Consensus         3 ~~y~~~~~i~~g~~~~v~~~~   23 (256)
T cd06612           3 EVFDILEKLGEGSYGSVYKAI   23 (256)
T ss_pred             ccchhhhhhcCCCCeEEEEEE
Confidence            689999999999999999885

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins

Probab=93.97  E-value=0.044  Score=36.11  Aligned_cols=22  Identities=32%  Similarity=0.449  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...|..++.||+|+||.||+|.
T Consensus        14 ~~~y~~~~~lg~g~~g~vy~~~   35 (307)
T cd06607          14 EKLFTDLREIGHGSFGAVYFAR   35 (307)
T ss_pred             chhhhhheeecCCCCeEEEEEE
Confidence            3569999999999999999985

Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily

>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6

Probab=93.92  E-value=0.028  Score=36.91  Aligned_cols=15  Identities=33%  Similarity=0.596  Sum_probs=13.5

Q ss_pred             ccccCCccceEeeec
Q psy17601         49 KVIGRGAFGECPKKI   63 (64)
Q Consensus        49 ~~iG~G~fG~V~La~   63 (64)
                      +.||+|+||.||+|.
T Consensus         7 ~~lG~G~~g~Vy~~~   21 (317)
T cd07867           7 CKVGRGTYGHVYKAK   21 (317)
T ss_pred             eEeccCCCeeEEEEE
Confidence            569999999999986

Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as

>KOG0658|consensus

Probab=93.92  E-value=0.022  Score=40.94  Aligned_cols=20  Identities=30%  Similarity=0.692  Sum_probs=17.8

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|...++||.|+||.||.|.
T Consensus        25 ~~~~~~liG~GsFg~Vyq~~   44 (364)
T KOG0658|consen   25 SYEAVRLIGSGSFGVVYQAK   44 (364)
T ss_pred             EEEeeEEEeecccceEEEEE
Confidence            47788999999999999985

>KOG1163|consensus

Probab=93.91  E-value=0.022  Score=40.05  Aligned_cols=23  Identities=26%  Similarity=0.449  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -...|.+++-||.|+||.+|+++
T Consensus        13 v~gky~lvrkiGsGSFGdIy~~~   35 (341)
T KOG1163|consen   13 VGGKYKLVRKIGSGSFGDIYLGI   35 (341)
T ss_pred             eccceEEEEeecCCchhheeeee
Confidence            44679999999999999999985

>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase

Probab=93.82  E-value=0.028  Score=37.96  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=20.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||.|+||.||+|++
T Consensus        13 ~~~~y~~~~~ig~g~~g~vy~~~~   36 (343)
T cd07851          13 VPDRYQNLSPVGSGAYGQVCSAFD   36 (343)
T ss_pred             ccCceEEEEEeccCCceEEEEEEE
Confidence            357899999999999999999863

Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK

>KOG0614|consensus

Probab=93.74  E-value=0.069  Score=40.78  Aligned_cols=28  Identities=18%  Similarity=0.415  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeec
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++.++|++++..||-|+||+|=|+.
T Consensus       413 e~a~v~l~dl~~iaTLGvGgFGRVELV~  440 (732)
T KOG0614|consen  413 EFAQVKLSDLKRIATLGVGGFGRVELVK  440 (732)
T ss_pred             hhcccchhhhhhhhhcccCccceEEEEE
Confidence            4568899999999999999999998874

>KOG0615|consensus

Probab=93.70  E-value=0.028  Score=41.42  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=18.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|.+.+.+|.|+||.|.||+
T Consensus       171 ~d~yii~~~LGsGafg~Vkla~  192 (475)
T KOG0615|consen  171 NDYYIISKTLGSGAFGLVKLAY  192 (475)
T ss_pred             cceeEeeeeecCCceeEEEEEE
Confidence            3556667799999999999996

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase

Probab=93.50  E-value=0.025  Score=36.60  Aligned_cols=20  Identities=35%  Similarity=0.622  Sum_probs=17.4

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |++++.||.|+||.||++.+
T Consensus         7 ~~i~~~lg~g~~g~v~~~~~   26 (282)
T cd06643           7 WEIIGELGDGAFGKVYKAQN   26 (282)
T ss_pred             HHHHhhcccCCCeEEEEEEE
Confidence            47889999999999998853

Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.

>KOG0594|consensus

Probab=93.50  E-value=0.017  Score=40.93  Aligned_cols=23  Identities=26%  Similarity=0.528  Sum_probs=20.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|+.+..||.|+||.||.|++
T Consensus        10 ~~~~~~~eklGeGtyg~Vykar~   32 (323)
T KOG0594|consen   10 MFDYEKVEKLGEGTYGVVYKARS   32 (323)
T ss_pred             HHHHHHHHHhCCCCceEEEEEEE
Confidence            56788899999999999999874

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases

Probab=93.49  E-value=0.041  Score=35.29  Aligned_cols=19  Identities=21%  Similarity=0.518  Sum_probs=16.7

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |.+.+.||.|+||+||+|.
T Consensus         3 ~~~~~~lg~g~~~~vy~~~   21 (272)
T cd06629           3 WVKGELIGKGTYGRVYLAL   21 (272)
T ss_pred             eeecceecccCceEEEEEe
Confidence            5667899999999999985

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte

>KOG1151|consensus

Probab=93.48  E-value=0.024  Score=42.84  Aligned_cols=22  Identities=36%  Similarity=0.703  Sum_probs=18.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|-.+.+||+|+|.+||.|+|
T Consensus       463 ~RYLlLhLLGrGGFSEVyKAFD  484 (775)
T KOG1151|consen  463 DRYLLLHLLGRGGFSEVYKAFD  484 (775)
T ss_pred             HHHHHHHHhccccHHHHHHhcc
Confidence            4566788999999999999986

>KOG0576|consensus

Probab=93.35  E-value=0.026  Score=43.77  Aligned_cols=23  Identities=35%  Similarity=0.709  Sum_probs=21.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+||+.+..+|.|+||.||.|+|
T Consensus        14 ~ddyellqrvgsgTygdvyKaRd   36 (829)
T KOG0576|consen   14 QDDYELLQRVGSGTYGDVYKARD   36 (829)
T ss_pred             ccchhheeeecCCcccchhhhcc
Confidence            48999999999999999999986

>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional

Probab=93.12  E-value=0.043  Score=35.65  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=16.7

Q ss_pred             CCCCccccc--cCCccceEeeec
Q psy17601         43 EDFEPLKVI--GRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~i--G~G~fG~V~La~   63 (64)
                      ++|++++.+  |.|+||.||++.
T Consensus        14 ~~~~~~~~~~lg~g~~g~v~~~~   36 (267)
T PHA03390         14 KNCEIVKKLKLIDGKFGKVSVLK   36 (267)
T ss_pred             HhhccccceeecCCCceEEEEEE
Confidence            456666655  999999999985

>KOG0611|consensus

Probab=92.97  E-value=0.028  Score=42.04  Aligned_cols=22  Identities=18%  Similarity=0.564  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.|++...||+|+||+|.+|++
T Consensus        53 HRyE~~etLGkGTYGKVk~A~e   74 (668)
T KOG0611|consen   53 HRYEITETLGKGTYGKVKLAYE   74 (668)
T ss_pred             hHHHHHHHhcCCcccceeehhh
Confidence            4799999999999999999974

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase

Probab=92.96  E-value=0.066  Score=34.31  Aligned_cols=24  Identities=21%  Similarity=0.353  Sum_probs=19.2

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+.+.....||+|+||.||.|.+
T Consensus         6 ~~~~~~~~~~lg~g~~g~v~~~~~   29 (268)
T cd06624           6 EYDENGERVVLGKGTYGIVYAARD   29 (268)
T ss_pred             ccccCCceEEEecCCceEEEEeEe
Confidence            445666677999999999999863

Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1

Probab=92.94  E-value=0.028  Score=36.31  Aligned_cols=22  Identities=55%  Similarity=0.833  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|..++.||.|+||.||+|.+
T Consensus         4 ~~y~~~~~l~~g~~~~vy~~~~   25 (277)
T cd06642           4 ELFTKLERIGKGSFGEVYKGID   25 (277)
T ss_pred             HHHHHHHHhcCCCCeeEEEEEE
Confidence            4577889999999999999853

Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1

Probab=92.88  E-value=0.043  Score=36.49  Aligned_cols=21  Identities=33%  Similarity=0.501  Sum_probs=18.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|..++.||+|+||.||+|.
T Consensus        25 ~~f~~~~~lg~G~~~~v~~~~   45 (317)
T cd06635          25 KLFTDLREIGHGSFGAVYFAR   45 (317)
T ss_pred             hhhhhhheeccCCCeEEEEEE
Confidence            458899999999999999986

Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron

>KOG0032|consensus

Probab=92.84  E-value=0.049  Score=38.82  Aligned_cols=21  Identities=33%  Similarity=0.457  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++.+.||+|+||.||.|.
T Consensus        35 ~~Y~l~~~lG~G~Fg~v~~~~   55 (382)
T KOG0032|consen   35 EKYELGRELGRGQFGVVYLCR   55 (382)
T ss_pred             ccEEehhhhCCCCceEEEEEE
Confidence            468888899999999999986

>PTZ00024 cyclin-dependent protein kinase; Provisional

Probab=92.79  E-value=0.056  Score=36.06  Aligned_cols=22  Identities=27%  Similarity=0.530  Sum_probs=17.2

Q ss_pred             CCCCc-cccccCCccceEeeecC
Q psy17601         43 EDFEP-LKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~-~~~iG~G~fG~V~La~~   64 (64)
                      +.|.. .++||.|+||.||+|.+
T Consensus         8 ~ry~~~~~~ig~G~~g~vy~~~~   30 (335)
T PTZ00024          8 ERYIQKGAHLGEGTYGKVEKAYD   30 (335)
T ss_pred             cchhhhhhcccCCCceeEEEEEE
Confidence            34554 46899999999999864

>KOG0194|consensus

Probab=92.79  E-value=0.055  Score=39.95  Aligned_cols=22  Identities=45%  Similarity=0.523  Sum_probs=17.7

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|-...+.||.|+||+|+.+.
T Consensus       156 H~~v~l~kkLGeGaFGeV~~G~  177 (474)
T KOG0194|consen  156 HSDIELGKKLGEGAFGEVFKGK  177 (474)
T ss_pred             ccCccccceeecccccEEEEEE
Confidence            3555667899999999999874

>smart00090 RIO RIO-like kinase

Probab=92.70  E-value=0.051  Score=35.98  Aligned_cols=20  Identities=10%  Similarity=-0.115  Sum_probs=18.1

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.+.+.||.|+||.||+|.
T Consensus        29 ~~~i~~~Lg~G~~g~Vy~a~   48 (237)
T smart00090       29 LSAIGGCISTGKEANVYHAL   48 (237)
T ss_pred             hHHhCCeeccCcceeEEEEE
Confidence            47788999999999999996

>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2

Probab=92.54  E-value=0.049  Score=35.96  Aligned_cols=21  Identities=29%  Similarity=0.477  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|.+++.||.|+||.||+|.
T Consensus        19 ~~y~~~~~lg~g~~g~vy~~~   39 (296)
T cd06655          19 KKYTRYEKIGQGASGTVFTAI   39 (296)
T ss_pred             ceEEEEEEEecCCCeEEEEEE
Confidence            569999999999999999886

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding

>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional

Probab=92.42  E-value=0.072  Score=35.88  Aligned_cols=22  Identities=9%  Similarity=-0.093  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -..|..++++|.|+||.|+|+.
T Consensus        30 ~~~y~~~~~l~~~~f~~v~l~~   51 (232)
T PRK10359         30 SYNIKTIKVFRNIDDTKVSLID   51 (232)
T ss_pred             hCceEEEEEecCCCceEEEEEe
Confidence            3579999999999999999974

>KOG0193|consensus

Probab=92.34  E-value=0.053  Score=41.53  Aligned_cols=22  Identities=27%  Similarity=0.335  Sum_probs=17.7

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++.+...||+|+||+||-++
T Consensus       391 ~~ev~l~~rIGsGsFGtV~Rg~  412 (678)
T KOG0193|consen  391 PEEVLLGERIGSGSFGTVYRGR  412 (678)
T ss_pred             HHHhhccceeccccccceeecc
Confidence            4556667799999999999765

>PTZ00267 NIMA-related protein kinase; Provisional

Probab=92.06  E-value=0.055  Score=38.65  Aligned_cols=21  Identities=10%  Similarity=0.066  Sum_probs=18.6

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|.+.+.||+|+||.||+|.+
T Consensus        68 ~y~~~~~lg~G~~g~vy~a~~   88 (478)
T PTZ00267         68 MYVLTTLVGRNPTTAAFVATR   88 (478)
T ss_pred             eEEEEEEEEeCCCcEEEEEEE
Confidence            388899999999999999863

>KOG0577|consensus

Probab=92.05  E-value=0.052  Score=42.21  Aligned_cols=20  Identities=40%  Similarity=0.655  Sum_probs=17.7

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |.=++-||.|+||-||.|+|
T Consensus        28 f~dLrEIGHGSFGAVYfArd   47 (948)
T KOG0577|consen   28 FSDLREIGHGSFGAVYFARD   47 (948)
T ss_pred             HHHHHHhcCCccceeEEeec
Confidence            66688899999999999986

>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain

Probab=91.62  E-value=0.11  Score=32.77  Aligned_cols=19  Identities=16%  Similarity=0.004  Sum_probs=16.6

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |.+.+.||.|+||.||.+.
T Consensus        17 ~~~~~~i~~G~~g~Vy~~~   35 (198)
T cd05144          17 ESLGNQIGVGKESDVYLAL   35 (198)
T ss_pred             hhcCCccccCcceEEEEEE
Confidence            6667899999999999875

The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom

>KOG0660|consensus

Probab=91.46  E-value=0.095  Score=37.67  Aligned_cols=22  Identities=32%  Similarity=0.516  Sum_probs=18.3

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..++.||+|+||.|+.|.|
T Consensus        22 ~~y~~~~~iG~GAyGvVcsA~~   43 (359)
T KOG0660|consen   22 RYYVLIEPIGRGAYGVVCSAKD   43 (359)
T ss_pred             ceecccccccCcceeeEEEEEE
Confidence            4566689999999999998864

>KOG1026|consensus

Probab=91.30  E-value=0.05  Score=42.36  Aligned_cols=24  Identities=25%  Similarity=0.296  Sum_probs=20.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..+|-..+.-||.|+||+||+|+
T Consensus       483 i~r~~i~~~~eLGegaFGkVf~a~  506 (774)
T KOG1026|consen  483 IPRSDIVFKEELGEGAFGKVFLAE  506 (774)
T ss_pred             echhheeehhhhcCchhhhhhhhh
Confidence            455677778889999999999985

>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2

Probab=91.28  E-value=0.068  Score=35.40  Aligned_cols=22  Identities=36%  Similarity=0.554  Sum_probs=18.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..++.||.|+||.||+|++
T Consensus        15 ~~~~~~~~lg~g~~g~v~~~~~   36 (308)
T cd06634          15 KLFSDLREIGHGSFGAVYFARD   36 (308)
T ss_pred             HHHHHHHheeeCCCEEEEEEEE
Confidence            3488889999999999999863

Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin

>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3

Probab=90.84  E-value=0.12  Score=34.37  Aligned_cols=19  Identities=37%  Similarity=0.550  Sum_probs=16.5

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |..+..||.|+||.||+|.
T Consensus        23 ~~~~~~lg~g~~g~v~~~~   41 (313)
T cd06633          23 FVGLHEIGHGSFGAVYFAT   41 (313)
T ss_pred             hhcceeeccCCCeEEEEEE
Confidence            6667789999999999985

Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co

>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase

Probab=90.72  E-value=0.12  Score=33.49  Aligned_cols=24  Identities=42%  Similarity=0.502  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+.|+..+.||.|+||.||.|.+
T Consensus        17 ~~~~~~~~~~l~~g~~~~v~~~~~   40 (286)
T cd06614          17 PRELYKNLEKIGEGASGEVYKATD   40 (286)
T ss_pred             ccccchHhHhccCCCCeEEEEEEE
Confidence            446799999999999999999863

Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou

>KOG0669|consensus

Probab=90.70  E-value=0.025  Score=40.03  Aligned_cols=22  Identities=45%  Similarity=0.715  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|+.+..||+|.||+|++|+
T Consensus        16 ~~~yek~~kigqGtfgeVFkAr   37 (376)
T KOG0669|consen   16 VSKYEKLAKIGQGTFGEVFKAR   37 (376)
T ss_pred             chHHHHHHhcCCchHHHHHHHh
Confidence            4678888999999999999986

>KOG1166|consensus

Probab=90.64  E-value=0.11  Score=41.46  Aligned_cols=23  Identities=35%  Similarity=0.476  Sum_probs=19.6

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-++|.|-+.||+|+||+||.|.
T Consensus       696 ~~~~~~I~~e~G~g~y~~vy~a~  718 (974)
T KOG1166|consen  696 GGEKFCISKEIGEGSYGSVYVAT  718 (974)
T ss_pred             cceeEEEEeeeccccceEEEEee
Confidence            34578888899999999999985

>KOG1187|consensus

Probab=90.53  E-value=0.15  Score=35.88  Aligned_cols=21  Identities=33%  Similarity=0.699  Sum_probs=18.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|..-.+||+|+||.||.+.
T Consensus        75 ~~Fs~~~~ig~Ggfg~VYkG~   95 (361)
T KOG1187|consen   75 NNFSESNLIGEGGFGTVYKGV   95 (361)
T ss_pred             hCCchhcceecCCCeEEEEEE
Confidence            678888899999999999763

>KOG0581|consensus

Probab=90.42  E-value=0.12  Score=37.22  Aligned_cols=25  Identities=32%  Similarity=0.437  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++++|++.+..||.|+-|.|++|+
T Consensus        75 ~i~~~dle~~~~lG~G~gG~V~kv~   99 (364)
T KOG0581|consen   75 GISLSDLERLGVLGSGNGGTVYKVR   99 (364)
T ss_pred             ccCHHHhhhhhhcccCCCcEEEEEE
Confidence            4566799999999999999999986

>KOG0575|consensus

Probab=89.97  E-value=0.15  Score=38.81  Aligned_cols=22  Identities=23%  Similarity=0.656  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..-++||+|+|..||.|+|
T Consensus        18 ~~Y~~g~~LGkGgFA~cYe~~~   39 (592)
T KOG0575|consen   18 KRYKRGRFLGKGGFARCYEARD   39 (592)
T ss_pred             ceeeeeeeeccCcceEEEEEEE
Confidence            4599999999999999999875

>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6

Probab=89.85  E-value=0.13  Score=33.90  Aligned_cols=22  Identities=23%  Similarity=0.187  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +-|+....||.|+||.||+|.+
T Consensus        21 ~~~~~~~~ig~g~~g~v~~~~~   42 (297)
T cd06659          21 SLLENYIKIGEGSTGIVCIARE   42 (297)
T ss_pred             hhHHhhhhcCCCCceeEEEEEE
Confidence            4566677899999999999853

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i

>KOG0606|consensus

Probab=89.78  E-value=0.23  Score=40.36  Aligned_cols=26  Identities=27%  Similarity=0.422  Sum_probs=22.7

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...-+||+.||+|-.|+||-||++++
T Consensus        79 ~p~e~df~~IklisngAygavylvrh  104 (1205)
T KOG0606|consen   79 APSESDFNTIKLISNGAYGAVYLVRH  104 (1205)
T ss_pred             CCCccccceeEeeccCCCCceeeeec
Confidence            34558999999999999999999964

>KOG1095|consensus

Probab=89.64  E-value=0.18  Score=40.47  Aligned_cols=23  Identities=35%  Similarity=0.648  Sum_probs=18.1

Q ss_pred             CCCCCCCccccccCCccceEeee
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La   62 (64)
                      ++.+.-.....||+|+||+||-+
T Consensus       689 v~~~~v~l~~~lG~G~FG~VY~g  711 (1025)
T KOG1095|consen  689 VPRKNVTLLRVLGKGAFGEVYEG  711 (1025)
T ss_pred             CChhheEeeeeeccccccceEEE
Confidence            34456666789999999999965

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional

Probab=89.61  E-value=0.18  Score=38.62  Aligned_cols=20  Identities=30%  Similarity=0.338  Sum_probs=16.9

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      +|....+||+|+||.||.|.
T Consensus       691 ~~~~~~~ig~G~~g~Vy~~~  710 (968)
T PLN00113        691 SLKEENVISRGKKGASYKGK  710 (968)
T ss_pred             hCCcccEEccCCCeeEEEEE
Confidence            45666789999999999986

>KOG0671|consensus

Probab=89.46  E-value=0.17  Score=36.99  Aligned_cols=23  Identities=26%  Similarity=0.611  Sum_probs=19.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...|.+++.+|.|+||+|..+.|
T Consensus        88 ~~Ry~i~~~lGeGtFGkV~ec~D  110 (415)
T KOG0671|consen   88 TNRYEIVDLLGEGTFGKVVECWD  110 (415)
T ss_pred             ccceehhhhhcCCcccceEEEee
Confidence            35689999999999999987764

>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5

Probab=88.64  E-value=0.16  Score=33.48  Aligned_cols=21  Identities=24%  Similarity=0.292  Sum_probs=17.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|..+..||.|+||.||+|.
T Consensus        22 ~~~~~~~~lg~g~~g~v~~~~   42 (292)
T cd06658          22 EYLDSFIKIGEGSTGIVCIAT   42 (292)
T ss_pred             HHHhhhhcccCCCCeEEEEEE
Confidence            456667889999999999885

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express

>KOG0197|consensus

Probab=88.57  E-value=0.091  Score=38.89  Aligned_cols=20  Identities=25%  Similarity=0.496  Sum_probs=16.1

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++-||+|.||+|++..
T Consensus       207 ~l~l~~~LG~G~FG~V~~g~  226 (468)
T KOG0197|consen  207 ELKLIRELGSGQFGEVWLGK  226 (468)
T ss_pred             HHHHHHHhcCCccceEEEEE
Confidence            34457789999999999874

>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase

Probab=88.43  E-value=0.21  Score=32.59  Aligned_cols=21  Identities=19%  Similarity=0.224  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|...+.||.|+||.||+|.
T Consensus        19 ~~~~~~~~lg~g~~g~v~~~~   39 (285)
T cd06648          19 SYLDNFVKIGEGSTGIVCIAT   39 (285)
T ss_pred             HhhhcceEeccCCCeEEEEEE
Confidence            356667899999999999985

Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun

>KOG0579|consensus

Probab=88.21  E-value=0.11  Score=40.94  Aligned_cols=25  Identities=32%  Similarity=0.607  Sum_probs=19.7

Q ss_pred             CCCC-CCCCccccccCCccceEeeec
Q psy17601         39 RLGV-EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~-~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++. +.+++|--||.|+||+||.|.
T Consensus        27 dlnP~d~WeIiGELGDGAFGKVyKA~   52 (1187)
T KOG0579|consen   27 DLNPRDHWEIIGELGDGAFGKVYKAV   52 (1187)
T ss_pred             cCCHHHHHHHHhhhcCccchhhhhhh
Confidence            4555 456778899999999999874

>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4

Probab=87.94  E-value=0.21  Score=32.90  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=15.9

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|+..+.||+|+||.||++.
T Consensus        21 ~~~~~~~lg~g~~g~v~~~~   40 (292)
T cd06657          21 YLDNFIKIGEGSTGIVCIAT   40 (292)
T ss_pred             HhhhHHHcCCCCCeEEEEEE
Confidence            34446789999999999874

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo

>KOG0586|consensus

Probab=87.92  E-value=0.29  Score=37.31  Aligned_cols=26  Identities=23%  Similarity=0.330  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+-.|.+++.||+|.|++|.||+.
T Consensus        52 ~~~vg~y~i~~tig~g~f~~V~La~~   77 (596)
T KOG0586|consen   52 SNSVGLYVIIKTIGKGNFAKVKLARH   77 (596)
T ss_pred             cccccceeeeeeeccceeEEEEeeEe
Confidence            44567899999999999999999863

>KOG4279|consensus

Probab=87.91  E-value=0.26  Score=39.24  Aligned_cols=15  Identities=33%  Similarity=0.727  Sum_probs=14.1

Q ss_pred             cccCCccceEeeecC
Q psy17601         50 VIGRGAFGECPKKID   64 (64)
Q Consensus        50 ~iG~G~fG~V~La~~   64 (64)
                      +||+|+||.||-|+|
T Consensus       582 VLGKGTYG~VYA~RD  596 (1226)
T KOG4279|consen  582 VLGKGTYGTVYAARD  596 (1226)
T ss_pred             EeecCceeEEEeecc
Confidence            799999999999986

>KOG0192|consensus

Probab=87.89  E-value=0.22  Score=35.34  Aligned_cols=24  Identities=25%  Similarity=0.480  Sum_probs=19.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..+++.+...||+|+||+||-+.
T Consensus        38 i~~~~l~~~~~iG~G~~g~V~~~~   61 (362)
T KOG0192|consen   38 IDPDELPIEEVLGSGSFGTVYKGK   61 (362)
T ss_pred             cChHHhhhhhhcccCCceeEEEEE
Confidence            445677777789999999999664

>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated

Probab=87.39  E-value=0.34  Score=35.33  Aligned_cols=19  Identities=32%  Similarity=0.340  Sum_probs=15.3

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |...+.||+|+||.||++.
T Consensus       335 ~~~~~~iG~G~~g~Vy~~~  353 (535)
T PRK09605        335 KIPDHLIGKGAEADIKKGE  353 (535)
T ss_pred             cCccceeccCCcEEEEEEe
Confidence            3456789999999999853

>KOG0662|consensus

Probab=86.96  E-value=0.28  Score=33.51  Aligned_cols=21  Identities=24%  Similarity=0.605  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|+.+.-||.|+||.|+.|+
T Consensus         2 ~~ydkmekigegtygtvfkar   22 (292)
T KOG0662|consen    2 QKYDKMEKIGEGTYGTVFKAR   22 (292)
T ss_pred             cchHHHHhhcCCcceeeEecc
Confidence            356778889999999999886

>PRK10345 hypothetical protein; Provisional

Probab=86.46  E-value=0.43  Score=31.27  Aligned_cols=17  Identities=18%  Similarity=0.427  Sum_probs=14.0

Q ss_pred             CCccccccCCccceEee
Q psy17601         45 FEPLKVIGRGAFGECPK   61 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~L   61 (64)
                      ......||+|+||.||.
T Consensus         4 L~~~~~LG~G~~~~Vy~   20 (210)
T PRK10345          4 LSEQSPLGTGRHRKCYA   20 (210)
T ss_pred             cCCcceecCCCceEEEE
Confidence            44567899999999985

>KOG1345|consensus

Probab=85.94  E-value=0.27  Score=35.18  Aligned_cols=25  Identities=20%  Similarity=0.392  Sum_probs=21.5

Q ss_pred             CCCC-CCCCccccccCCccceEeeec
Q psy17601         39 RLGV-EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~-~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.+ +.|.+.+++|.|-||++.||+
T Consensus        19 kv~l~d~y~I~k~lgeG~FgkIlL~e   44 (378)
T KOG1345|consen   19 KVDLEDVYTINKQLGEGRFGKILLAE   44 (378)
T ss_pred             ccchhhhhhHHHHhcccceeeEEeee
Confidence            3444 789999999999999999986

>KOG3653|consensus

Probab=84.37  E-value=0.44  Score=35.82  Aligned_cols=23  Identities=35%  Similarity=0.569  Sum_probs=18.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++...+.+.+||+|.||.||.|-
T Consensus       208 ~l~pl~l~eli~~Grfg~V~Kaq  230 (534)
T KOG3653|consen  208 ELDPLQLLELIGRGRFGCVWKAQ  230 (534)
T ss_pred             cCCchhhHHHhhcCccceeehhh
Confidence            45566667799999999999873

>KOG1290|consensus

Probab=83.58  E-value=0.49  Score=35.86  Aligned_cols=22  Identities=18%  Similarity=0.279  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|-+++-||=|+|.+||||.|
T Consensus        78 gRY~v~rKLGWGHFSTVWLawD   99 (590)
T KOG1290|consen   78 GRYHVQRKLGWGHFSTVWLAWD   99 (590)
T ss_pred             ceEEEEEeccccccceeEEEee
Confidence            4566888999999999999976

>KOG2345|consensus

Probab=82.39  E-value=0.6  Score=32.83  Aligned_cols=25  Identities=12%  Similarity=0.256  Sum_probs=21.8

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++-+.|.+.+.+|.|+|.-|+|+.
T Consensus        17 ~In~~Ryri~~~LgeGGfsfv~LV~   41 (302)
T KOG2345|consen   17 IINNKRYRIQRLLGEGGFSFVDLVK   41 (302)
T ss_pred             EEcCceEEEeeeecCCCceeeeeec
Confidence            4566789999999999999999985

>PRK12274 serine/threonine protein kinase; Provisional

Probab=82.05  E-value=0.92  Score=30.52  Aligned_cols=20  Identities=10%  Similarity=-0.039  Sum_probs=16.6

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      +.+..+|++|+||+|+++.+
T Consensus         4 ~~~~~~l~~~~f~~v~~~~~   23 (218)
T PRK12274          4 PAVNEPLKSDTFGRILLVRG   23 (218)
T ss_pred             cccceeecCCCcceEEEeec
Confidence            45677899999999999853

>PF13035 DUF3896: Protein of unknown function (DUF3896)

Probab=81.17  E-value=3.2  Score=22.56  Aligned_cols=28  Identities=25%  Similarity=0.312  Sum_probs=22.0

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQKE   29 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~e   29 (64)
                      ++|-++|.++.|++++++++.-.....|
T Consensus        19 q~lc~kls~~~ls~~er~qi~~eidnye   46 (61)
T PF13035_consen   19 QQLCKKLSSMHLSEKEREQIKLEIDNYE   46 (61)
T ss_pred             HHHHHHHhhcccCHHHHHHHHhhhhhHH
Confidence            4677899999999999998876655443

>KOG0584|consensus

Probab=81.16  E-value=0.76  Score=35.30  Aligned_cols=15  Identities=53%  Similarity=0.837  Sum_probs=14.2

Q ss_pred             cccCCccceEeeecC
Q psy17601         50 VIGRGAFGECPKKID   64 (64)
Q Consensus        50 ~iG~G~fG~V~La~~   64 (64)
                      +||+|+|-+||.|+|
T Consensus        47 vLGrGafKtVYka~D   61 (632)
T KOG0584|consen   47 VLGRGAFKTVYKAFD   61 (632)
T ss_pred             hcccccceeeeeccc
Confidence            899999999999987

>KOG0668|consensus

Probab=80.98  E-value=0.27  Score=34.56  Aligned_cols=23  Identities=30%  Similarity=0.655  Sum_probs=20.6

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+||++++-+|+|.|.+|+-++
T Consensus        36 ~~ddYeivrk~GRGKYSEVFeg~   58 (338)
T KOG0668|consen   36 NQDDYEIVRKVGRGKYSEVFEGI   58 (338)
T ss_pred             ccchHHHHHHHcCccHhhHhccc
Confidence            67999999999999999998654

>KOG2052|consensus

Probab=80.35  E-value=0.73  Score=34.50  Aligned_cols=21  Identities=29%  Similarity=0.501  Sum_probs=17.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+-.++.+||+|-||+||-+.
T Consensus       211 rqI~L~e~IGkGRyGEVwrG~  231 (513)
T KOG2052|consen  211 RQIVLQEIIGKGRFGEVWRGR  231 (513)
T ss_pred             heeEEEEEecCccccceeecc
Confidence            567778899999999998754

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Length	Definition	E-value
Query	64
4aw2_A	437	Crystal Structure Of Cdc42 Binding Protein Kinase A		6e-04

>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437

Iteration: 1
 Score = 39.3 bits (90), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 21/25 (84%)
Query: 34 RLKRSRLGVEDFEPLKVIGRGAFGE 58
          ++K+ RL  EDFE LKVIGRGAFGE
Sbjct: 65 KVKQMRLHREDFEILKVIGRGAFGE 89

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	64
2vd5_A	412	DMPK protein; serine/threonine-protein kinase, kin	5e-10
4aw2_A	437	Serine/threonine-protein kinase MRCK alpha; transf	1e-08
3v8s_A	410	RHO-associated protein kinase 1; dimerization, myo	1e-08
1vzo_A	355	Ribosomal protein S6 kinase alpha 5; protein kinas	6e-06
4dc2_A	396	Protein kinase C IOTA type; kinase, substrate, cel	6e-06
3a62_A	327	Ribosomal protein S6 kinase beta-1; kinase domain,	1e-05
3c4z_A	543	Rhodopsin kinase; Ser/Thr kinase, RGS homology dom	1e-05
3pfq_A	674	PKC-B, PKC-beta, protein kinase C beta type; phosp	2e-05
3g51_A	325	Ribosomal protein S6 kinase alpha-3; N-terminal ki	2e-05
2acx_A	576	G protein-coupled receptor kinase 6; GRK, G transf	2e-05
2r5t_A	373	Serine/threonine-protein kinase SGK1; AGC protein	3e-05
2i0e_A	353	Protein kinase C-beta II; serine/threonine protein	3e-05
3txo_A	353	PKC-L, NPKC-ETA, protein kinase C ETA type; phosph	4e-05
3a8x_A	345	Protein kinase C IOTA type; transferase; HET: TPO;	4e-05
1xjd_A	345	Protein kinase C, theta type; PKC-theta, ATP, AMP,	5e-05
1o6l_A	337	RAC-beta serine/threonine protein kinase; protein	1e-04
4ejn_A	446	RAC-alpha serine/threonine-protein kinase; AKT1, a	1e-04
1rdq_E	350	PKA C-alpha, CAMP-dependent protein kinase, alpha-	2e-04
3pvu_A	695	Beta-adrenergic receptor kinase 1; transferase, se	4e-04
1uu3_A	310	HPDK1, 3-phosphoinositide dependent protein kinase	4e-04
1fot_A	318	TPK1 delta, CAMP-dependent protein kinase type 1;	6e-04
4fr4_A	384	YANK1, serine/threonine-protein kinase 32A; struct	8e-04

>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412

 Score = 52.0 bits (125), Expect = 5e-10
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 6  ESLKDESLSETQRQEKRQQ--HAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
            +  E  +    Q+K         E   +RLK  RL  +DFE LKVIGRGAF E
Sbjct: 22 LGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDDFEILKVIGRGAFSE 76

>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437

 Score = 48.2 bits (115), Expect = 1e-08
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 6  ESLKDESLSETQRQEKRQQH--AQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
            L DE  +   R+EK         +    ++K+ RL  EDFE LKVIGRGAFGE
Sbjct: 35 ICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGE 89

>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410

 Score = 47.8 bits (114), Expect = 1e-08
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 4  LEESLKDESLSETQRQEKRQQHAQK-ETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
          L+  + D      ++ +       + +    +++  R+  ED+E +KVIGRGAFGE
Sbjct: 29 LDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGE 84

>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355

 Score = 40.3 bits (95), Expect = 6e-06
 Identities = 13/53 (24%), Positives = 24/53 (45%)

Query: 5  EESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
            +    +      ++      +  T  L     ++G+E+FE LKV+G GA+G
Sbjct: 16 GGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYG 68

>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396

 Score = 40.4 bits (95), Expect = 6e-06
 Identities = 12/52 (23%), Positives = 23/52 (44%)

Query: 6  ESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
           + ++            ++     T       S LG++DF+ L+VIGRG++ 
Sbjct: 15 PTTENLYFQGAMGSGIEEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYA 66

>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327

 Score = 39.8 bits (94), Expect = 1e-05
 Identities = 8/25 (32%), Positives = 15/25 (60%)

Query: 33 LRLKRSRLGVEDFEPLKVIGRGAFG 57
          +     ++  E FE L+V+G+G +G
Sbjct: 7  VNRGPEKIRPECFELLRVLGKGGYG 31

>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543

 Score = 39.8 bits (93), Expect = 1e-05
 Identities = 13/57 (22%), Positives = 21/57 (36%), Gaps = 4/57 (7%)

Query: 2   AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
             +   L      E        +  Q    +  L+   +G + F   +V+GRG FGE
Sbjct: 148 RAVLAHLGQAPFQEFLDSLYFLRFLQ----WKWLEAQPMGEDWFLDFRVLGRGGFGE 200

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674

 Score = 39.2 bits (91), Expect = 2e-05
 Identities = 11/57 (19%), Positives = 24/57 (42%)

Query: 1   QAKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
             +L +  +   + +  +  + +             R R+ + DF  L V+G+G+FG
Sbjct: 299 NEELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFG 355

>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325

 Score = 39.1 bits (92), Expect = 2e-05
 Identities = 10/28 (35%), Positives = 16/28 (57%)

Query: 30 TEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
          T  ++    +     FE LKV+G+G+FG
Sbjct: 11 THHVKEGHEKADPSQFELLKVLGQGSFG 38

>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576

 Score = 39.0 bits (91), Expect = 2e-05
 Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 4/53 (7%)

Query: 6   ESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           E L     ++        +  Q    +  L+R  +    F   +V+G+G FGE
Sbjct: 151 EYLSVAPFADYLDSIYFNRFLQ----WKWLERQPVTKNTFRQYRVLGKGGFGE 199

>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373

 Score = 38.4 bits (90), Expect = 3e-05
 Identities = 10/44 (22%), Positives = 14/44 (31%)

Query: 14 SETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
                        ++              DF  LKVIG+G+FG
Sbjct: 9  ELMNANPAPPPAPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFG 52

>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353

 Score = 38.4 bits (90), Expect = 3e-05
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 36 KRSRLGVEDFEPLKVIGRGAFG 57
           R R+ + DF  L V+G+G+FG
Sbjct: 13 NRDRMKLTDFNFLMVLGKGSFG 34

>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353

 Score = 38.0 bits (89), Expect = 4e-05
 Identities = 10/22 (45%), Positives = 19/22 (86%)

Query: 36 KRSRLGVEDFEPLKVIGRGAFG 57
            +RLG+++FE ++V+G+G+FG
Sbjct: 16 SSNRLGIDNFEFIRVLGKGSFG 37

>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345

 Score = 38.0 bits (89), Expect = 4e-05
 Identities = 10/21 (47%), Positives = 16/21 (76%)

Query: 37 RSRLGVEDFEPLKVIGRGAFG 57
             LG++DF+ L+VIGRG++ 
Sbjct: 3  MDPLGLQDFDLLRVIGRGSYA 23

>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345

 Score = 37.6 bits (88), Expect = 5e-05
 Identities = 9/22 (40%), Positives = 16/22 (72%)

Query: 36 KRSRLGVEDFEPLKVIGRGAFG 57
           + +L +EDF   K++G+G+FG
Sbjct: 10 LQIKLKIEDFILHKMLGKGSFG 31

>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337

 Score = 36.8 bits (86), Expect = 1e-04
 Identities = 8/19 (42%), Positives = 15/19 (78%)

Query: 39 RLGVEDFEPLKVIGRGAFG 57
          ++ + DF+ LK++G+G FG
Sbjct: 1  KVTMNDFDYLKLLGKGTFG 19

>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446

 Score = 36.6 bits (85), Expect = 1e-04
 Identities = 9/22 (40%), Positives = 16/22 (72%)

Query: 36  KRSRLGVEDFEPLKVIGRGAFG 57
            + R+ + +FE LK++G+G FG
Sbjct: 141 PKHRVTMNEFEYLKLLGKGTFG 162

>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350

 Score = 36.1 bits (84), Expect = 2e-04
 Identities = 9/52 (17%), Positives = 24/52 (46%)

Query: 6  ESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
           + K  S  E+ ++   +       ++    ++   ++ F+ +K +G G+FG
Sbjct: 4  AAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFG 55

>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695

 Score = 35.2 bits (81), Expect = 4e-04
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 6   ESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
           ++L+ +   +    +K  +  Q +   L +    L + DF   ++IGRG FGE
Sbjct: 155 QNLRGDVFQKFIESDKFTRFCQWKNVELNIH---LTMNDFSVHRIIGRGGFGE 204

>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310

 Score = 35.3 bits (82), Expect = 4e-04
 Identities = 7/29 (24%), Positives = 14/29 (48%)

Query: 29 ETEFLRLKRSRLGVEDFEPLKVIGRGAFG 57
          +      +  +   EDF+  K++G G+F 
Sbjct: 16 QHAQPPPQPRKKRPEDFKFGKILGEGSFS 44

>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318

 Score = 34.4 bits (80), Expect = 6e-04
 Identities = 7/19 (36%), Positives = 14/19 (73%)

Query: 39 RLGVEDFEPLKVIGRGAFG 57
          +  ++DF+ L+ +G G+FG
Sbjct: 2  KYSLQDFQILRTLGTGSFG 20

>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384

 Score = 34.2 bits (79), Expect = 8e-04
 Identities = 8/22 (36%), Positives = 14/22 (63%)

Query: 36 KRSRLGVEDFEPLKVIGRGAFG 57
          +   +  + FE L+ IG+G+FG
Sbjct: 8  ENEDVNFDHFEILRAIGKGSFG 29

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	64
3ubd_A	304	Ribosomal protein S6 kinase alpha-3; kinase-inhibi	98.07
3v5w_A	689	G-protein coupled receptor kinase 2; inhibitor com	97.99
2vd5_A	412	DMPK protein; serine/threonine-protein kinase, kin	97.92
4aw0_A	311	HPDK1, 3-phosphoinositide-dependent protein kinase	97.91
3v8s_A	410	RHO-associated protein kinase 1; dimerization, myo	97.85
4g31_A	299	Eukaryotic translation initiation factor 2-alpha;	97.83
4b9d_A	350	Serine/threonine-protein kinase NEK1; transferase,	97.8
3hyh_A	275	Carbon catabolite-derepressing protein kinase; kin	97.73
3eqc_A	360	Dual specificity mitogen-activated protein kinase;	97.7
1o6l_A	337	RAC-beta serine/threonine protein kinase; protein	97.62
4b99_A	398	Mitogen-activated protein kinase 7; transferase, i	97.62
2r5t_A	373	Serine/threonine-protein kinase SGK1; AGC protein	97.56
2i0e_A	353	Protein kinase C-beta II; serine/threonine protein	97.54
4aw2_A	437	Serine/threonine-protein kinase MRCK alpha; transf	97.54
3txo_A	353	PKC-L, NPKC-ETA, protein kinase C ETA type; phosph	97.52
1fot_A	318	TPK1 delta, CAMP-dependent protein kinase type 1;	97.52
3pfq_A	674	PKC-B, PKC-beta, protein kinase C beta type; phosp	97.51
4f9c_A	361	Cell division cycle 7-related protein kinase; Ser/	97.49
1rdq_E	350	PKA C-alpha, CAMP-dependent protein kinase, alpha-	97.48
1xjd_A	345	Protein kinase C, theta type; PKC-theta, ATP, AMP,	97.47
4dc2_A	396	Protein kinase C IOTA type; kinase, substrate, cel	97.47
3omv_A	307	RAF proto-oncogene serine/threonine-protein kinas;	97.44
4ase_A	353	Vascular endothelial growth factor receptor 2; tra	97.43
4fr4_A	384	YANK1, serine/threonine-protein kinase 32A; struct	97.42
3a8x_A	345	Protein kinase C IOTA type; transferase; HET: TPO;	97.42
4asz_A	299	BDNF/NT-3 growth factors receptor; transferase, TR	97.36
3fdn_A	279	Serine/threonine-protein kinase 6; aurora kinase i	97.31
4gt4_A	308	Tyrosine-protein kinase transmembrane receptor RO;	97.3
4fih_A	346	Serine/threonine-protein kinase PAK 4; kinase doma	97.29
4g3f_A	336	NF-kappa-beta-inducing kinase; non-RD kinase, prot	97.21
3kex_A	325	Receptor tyrosine-protein kinase ERBB-3; kinase do	97.2
4fie_A	423	Serine/threonine-protein kinase PAK 4; kinase doma	97.2
3uto_A	573	Twitchin; kinase, muscle sarcomere, transferase; H	97.2
3fme_A	290	Dual specificity mitogen-activated protein kinase;	97.17
3o0g_A	292	Cell division protein kinase 5; kinase activator c	97.16
3g2f_A	336	Bone morphogenetic protein receptor type-2; kinase	97.12
4f0f_A	287	Serine/threonine-protein kinase ROCO4; LRRK2, ATP-	97.12
3c4z_A	543	Rhodopsin kinase; Ser/Thr kinase, RGS homology dom	97.12
4aoj_A	329	High affinity nerve growth factor receptor; transf	97.11
1vzo_A	355	Ribosomal protein S6 kinase alpha 5; protein kinas	97.11
3g33_A	308	Cell division protein kinase 4; Ser/Thr protein ki	97.08
3a62_A	327	Ribosomal protein S6 kinase beta-1; kinase domain,	97.07
2zv2_A	298	Calcium/calmodulin-dependent protein kinase kinas;	97.07
2psq_A	370	Fibroblast growth factor receptor 2; kinase domain	97.06
2eue_A	275	Carbon catabolite derepressing protein kinase; kin	97.05
2acx_A	576	G protein-coupled receptor kinase 6; GRK, G transf	97.05
2pmi_A	317	Negative RE, cyclin-dependent protein kinase PHO85	97.03
4ejn_A	446	RAC-alpha serine/threonine-protein kinase; AKT1, a	97.02
3lzb_A	327	Epidermal growth factor receptor; epidermal growth	97.02
3lb7_A	307	RAF proto-oncogene serine/threonine-protein kinas;	97.02
3qd2_B	332	Eukaryotic translation initiation factor 2-alpha;	97.01
1ob3_A	288	PFPK5, cell division control protein 2 homolog; tr	97.01
3kmu_A	271	ILK, integrin-linked kinase; cell adhesion, ANK re	97.01
3mtl_A	324	Cell division protein kinase 16; pctaire1, indirub	97.0
3an0_A	340	Dual specificity mitogen-activated protein kinase;	96.98
3fe3_A	328	MAP/microtubule affinity-regulating kinase 3; seri	96.97
3tki_A	323	Serine/threonine-protein kinase CHK1; cell checkpo	96.96
3rp9_A	458	Mitogen-activated protein kinase; structural genom	96.94
3soc_A	322	Activin receptor type-2A; structural genomics cons	96.93
4hcu_A	269	Tyrosine-protein kinase ITK/TSK; transferase-trans	96.9
2r3i_A	299	Cell division protein kinase 2; serine/threonine-p	96.9
3oz6_A	388	Mitogen-activated protein kinase 1, serine/threon	96.89
3niz_A	311	Rhodanese family protein; structural genomics, str	96.88
1fvr_A	327	Tyrosine-protein kinase TIE-2; tyrosine kinase, tr	96.88
3op5_A	364	Serine/threonine-protein kinase VRK1; adenosine tr	96.88
3mi9_A	351	Cell division protein kinase 9; P-TEFB, HIV-1, pro	96.88
2vwi_A	303	Serine/threonine-protein kinase OSR1; STE kinase,	96.87
3poz_A	327	Epidermal growth factor receptor; kinase domain, a	96.86
2vuw_A	336	Serine/threonine-protein kinase haspin; cell cycle	96.86
4fvq_A	289	Tyrosine-protein kinase JAK2; janus protein kinase	96.86
3gen_A	283	Tyrosine-protein kinase BTK; bruton'S tyrosine kin	96.86
3dbq_A	343	Dual specificity protein kinase TTK; MPS1 structur	96.85
3aln_A	327	Dual specificity mitogen-activated protein kinase;	96.85
2vgo_A	284	Serine/threonine-protein kinase 12-A; nucleotide-b	96.85
3uim_A	326	Brassinosteroid insensitive 1-associated receptor;	96.84
3uc3_A	361	Serine/threonine-protein kinase SRK2I; SNRK2, ABA	96.84
3l9p_A	367	Anaplastic lymphoma kinase; kinase domain, ATP-bin	96.83
3e3p_A	360	Protein kinase, putative glycogen synthase kinase;	96.83
4agu_A	311	Cyclin-dependent kinase-like 1; transferase, phosp	96.82
3eb0_A	383	Putative uncharacterized protein; kinase cryptospo	96.82
2wtk_C	305	Serine/threonine-protein kinase 11; transferase-me	96.82
3llt_A	360	Serine/threonine kinase-1, pflammer; lammer kinase	96.8
3fxz_A	297	Serine/threonine-protein kinase PAK 1; transferase	96.79
1mp8_A	281	Focal adhesion kinase 1; tyrosine protein kinase,	96.79
3kul_A	325	Ephrin type-A receptor 8; ATP-binding, kinase, nuc	96.79
3q4u_A	301	Activin receptor type-1; structural genomics conso	96.79
2y4i_B	319	KSR2, HKSR2, kinase suppressor of RAS 2; transfera	96.79
3ttj_A	464	Mitogen-activated protein kinase 10; JNK3, protein	96.78
2qkw_B	321	Protein kinase; three-helix bundle motif, AVRPTO-P	96.78
1luf_A	343	Muscle-specific tyrosine kinase receptor MUSK; pho	96.78
1wak_A	397	Serine/threonine-protein kinase SPRK1; SRPK, trans	96.78
3s95_A	310	LIMK-1, LIM domain kinase 1; structural genomics,	96.77
4aaa_A	331	Cyclin-dependent kinase-like 2; transferase, phosp	96.76
2pvf_A	334	Fibroblast growth factor receptor 2; kinase domain	96.76
3gxj_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	96.75
3h4j_B	336	AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin	96.75
3dtc_A	271	Mitogen-activated protein kinase kinase kinase 9;	96.74
2izr_A	330	Casein kinase I isoform gamma-3; serine/threonine-	96.74
3zgw_A	347	Maternal embryonic leucine zipper kinase; transfer	96.73
3ugc_A	295	Tyrosine-protein kinase JAK2; small molecule inhib	96.73
3hmm_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	96.73
3nsz_A	330	CK II alpha, casein kinase II subunit alpha; inhib	96.73
2eva_A	307	TAK1 kinase - TAB1 chimera fusion protein; transfe	96.72
3ork_A	311	Serine/threonine protein kinase; structural genomi	96.72
3qup_A	323	Tyrosine-protein kinase receptor TYRO3; protein ki	96.7
2i1m_A	333	Macrophage colony-stimulating factor 1 receptor; k	96.7
2vx3_A	382	Dual specificity tyrosine-phosphorylation- regula	96.69
2qol_A	373	Ephrin receptor; receptor tyrosine kinase, juxtame	96.68
2dyl_A	318	Dual specificity mitogen-activated protein kinase	96.67
2j7t_A	302	Serine/threonine-protein kinase 10; transferase, A	96.67
3p86_A	309	Serine/threonine-protein kinase CTR1; ETR1, ERS1,	96.66
3og7_A	289	AKAP9-BRAF fusion protein; proto-oncogene, V600E,	96.65
3gbz_A	329	Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-	96.65
2xrw_A	371	Mitogen-activated protein kinase 8; transcription,	96.64
3qyz_A	364	Mitogen-activated protein kinase 1; transferase, s	96.64
4hgt_A	296	Casein kinase I isoform delta; CK1D, inhibitor, tr	96.63
4eqm_A	294	Protein kinase; transferase; HET: ANP; 3.00A {Stap	96.63
2ivs_A	314	Proto-oncogene tyrosine-protein kinase receptor RE	96.62
1z57_A	339	Dual specificity protein kinase CLK1; protein tyro	96.62
2zmd_A	390	Dual specificity protein kinase TTK; MPS1, T686A,	96.62
3kvw_A	429	DYRK2, dual specificity tyrosine-phosphorylation-r	96.62
2xir_A	316	Vascular endothelial growth factor receptor 2; ang	96.62
1byg_A	278	CSK, protein (C-terminal SRC kinase); protein kina	96.61
3uqc_A	286	Probable conserved transmembrane protein; structur	96.61
1rjb_A	344	FL cytokine receptor; kinase, structure, autoinhib	96.61
1q8y_A	373	SR protein kinase; transferase; HET: ADP ADE; 2.05	96.61
3tt0_A	382	Basic fibroblast growth factor receptor 1; kinase	96.6
2w5a_A	279	Serine/threonine-protein kinase NEK2; Ser/Thr prot	96.6
2yfx_A	327	Tyrosine-protein kinase receptor; nucleotide-bindi	96.6
3p1a_A	311	MYT1 kinase, membrane-associated tyrosine- and thr	96.58
3i6u_A	419	CDS1, serine/threonine-protein kinase CHK2; Ser/Th	96.58
2pml_X	348	PFPK7, Ser/Thr protein kinase; phosphorylati trans	96.58
3sxs_A	268	Cytoplasmic tyrosine-protein kinase BMX; transfera	96.58
3a99_A	320	Proto-oncogene serine/threonine-protein kinase PI;	96.57
3cc6_A	281	Protein tyrosine kinase 2 beta; focal adhesion kin	96.56
3vhe_A	359	Vascular endothelial growth factor receptor 2; kin	96.55
3t9t_A	267	Tyrosine-protein kinase ITK/TSK; kinase domain, al	96.54
1tki_A	321	Titin; serine kinase, muscle, autoinhibition; 2.00	96.54
2fst_X	367	Mitogen-activated protein kinase 14; active mutant	96.53
2eu9_A	355	Dual specificity protein kinase CLK3; kinase domai	96.53
3n9x_A	432	Phosphotransferase; malaria kinase, structural gen	96.52
1t46_A	313	HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom	96.51
3cek_A	313	Dual specificity protein kinase TTK; HMPS1, PYT, E	96.51
2i6l_A	320	Mitogen-activated protein kinase 6; MAPK6, ERK3, e	96.5
3e7e_A	365	HBUB1, BUB1A, mitotic checkpoint serine/threonine-	96.5
2h6d_A	276	5'-AMP-activated protein kinase catalytic subunit	96.49
3cok_A	278	Serine/threonine-protein kinase PLK4; POLO-like ki	96.48
2qr7_A	342	Ribosomal protein S6 kinase alpha-3; kinase domain	96.48
2iwi_A	312	Serine/threonine-protein kinase PIM-2; nucleotide-	96.47
2b9h_A	353	MAP kinase FUS3, mitogen-activated protein kinase	96.47
1cm8_A	367	Phosphorylated MAP kinase P38-gamma; phosphorylati	96.47
3pg1_A	362	Mitogen-activated protein kinase, putative (MAP K	96.46
3dls_A	335	PAS domain-containing serine/threonine-protein KI;	96.46
1ua2_A	346	CAK, cell division protein kinase 7; cell cycle, p	96.46
3kfa_A	288	Tyrosine-protein kinase ABL1; CML, drug resistance	96.45
2v62_A	345	Serine/threonine-protein kinase VRK2; transferase,	96.45
2y94_A	476	5'-AMP-activated protein kinase catalytic subunit;	96.44
1blx_A	326	Cyclin-dependent kinase 6; inhibitor protein, cycl	96.44
2yex_A	276	Serine/threonine-protein kinase CHK1; transferase,	96.43
3is5_A	285	Calcium-dependent protein kinase; CDPK, structural	96.42
3fpq_A	290	Serine/threonine-protein kinase WNK1; protein seri	96.42
3q5i_A	504	Protein kinase; CDPK, malaria, phosphotransferase,	96.41
2yab_A	361	Death-associated protein kinase 2; apoptosis, tran	96.41
2ycf_A	322	Serine/threonine-protein kinase CHK2; transferase,	96.41
4euu_A	319	Serine/threonine-protein kinase TBK1; ATP binding,	96.4
1zy4_A	303	Serine/threonine-protein kinase GCN2; translation	96.4
3cbl_A	377	C-FES, proto-oncogene tyrosine-protein kinase FES/	96.39
1phk_A	298	Phosphorylase kinase; glycogen metabolism, transfe	96.39
1p4o_A	322	Insulin-like growth factor I receptor protein; IGF	96.38
2ac3_A	316	MAP kinase-interacting serine/threonine kinase 2;	96.38
2wqm_A	310	Serine/threonine-protein kinase NEK7; ATP-binding,	96.38
2h34_A	309	Serine/threonine-protein kinase PKNE; apoenzyme, t	96.38
3kk8_A	284	Calcium/calmodulin dependent protein kinase II; AT	96.37
3uzp_A	296	CKI-delta, CKID, casein kinase I isoform delta; CK	96.37
1mqb_A	333	Ephrin type-A receptor 2; tyrosine protein kinase,	96.37
1qpc_A	279	LCK kinase; alpha beta fold, transferase; HET: PTR	96.36
4exu_A	371	Mitogen-activated protein kinase 13; P38 kinase, t	96.36
1x8b_A	289	WEE1HU, WEE1-like protein kinase; cell cycle, tran	96.35
1j1b_A	420	Glycogen synthase kinase-3 beta; complex, TAU, AMP	96.35
2buj_A	317	Serine/threonine-protein kinase 16; transferase, A	96.35
1csn_A	298	Casein kinase-1; phosphotransferase; HET: ATP; 2.0	96.35
3mdy_A	337	Bone morphogenetic protein receptor type-1B; compl	96.33
4e7w_A	394	Glycogen synthase kinase 3; GSK3, PTyr195, transfe	96.32
1u46_A	291	ACK-1, activated CDC42 kinase 1; tyrosine kinase,	96.32
1k9a_A	450	Carboxyl-terminal SRC kinase; COOH-terminal SRC ki	96.31
1qcf_A	454	Haematopoetic cell kinase (HCK); tyrosine kinase-i	96.3
2w4o_A	349	Calcium/calmodulin-dependent protein kinase type I	96.3
3sv0_A	483	Casein kinase I-like; typical kinase domain fold,	96.29
3com_A	314	Serine/threonine-protein kinase 4; MST1, STE20-lik	96.28
3ll6_A	337	Cyclin G-associated kinase; transferase, protein k	96.27
3hko_A	345	Calcium/calmodulin-dependent protein kinase with d	96.26
1nxk_A	400	MAP kinase-activated protein kinase 2; MK2, phosph	96.26
2a19_B	284	Interferon-induced, double-stranded RNA-activated	96.25
3brb_A	313	Proto-oncogene tyrosine-protein kinase MER; ATP-bi	96.24
1kob_A	387	Twitchin; kinase, intrasteric regulation; 2.30A {A	96.23
3byv_A	377	Rhoptry kinase; malaria, transferase, structural g	96.23
3lxl_A	327	Tyrosine-protein kinase JAK3; TYK2, inflammation,	96.22
3mwu_A	486	Calmodulin-domain protein kinase 1; serine/threoni	96.22
3m2w_A	299	MAP kinase-activated protein kinase 2; small molec	96.22
4e5w_A	302	Tyrosine-protein kinase JAK1; kinase domain, trans	96.22
3coi_A	353	Mitogen-activated protein kinase 13; P38D, P38delt	96.2
3a7i_A	303	MST3 kinase, serine/threonine kinase 24 (STE20 hom	96.19
3lij_A	494	Calcium/calmodulin dependent protein kinase with A	96.18
2rku_A	294	Serine/threonine-protein kinase PLK1; structure of	96.18
2a2a_A	321	Death-associated protein kinase 2; autoinhibition,	96.17
3c0i_A	351	Peripheral plasma membrane protein CASK; neurexin,	96.17
2clq_A	295	Mitogen-activated protein kinase kinase kinase 5;	96.16
3q60_A	371	ROP5B; pseudokinase, transferase; HET: ATP; 1.72A	96.14
2w1i_A	326	JAK2; chromosomal rearrangement, nucleotide-bindin	96.14
4eut_A	396	Serine/threonine-protein kinase TBK1; ATP binding,	96.13
2x7f_A	326	TRAF2 and NCK-interacting protein kinase; serine/t	96.12
3bhy_A	283	Death-associated protein kinase 3; death associate	96.11
2y0a_A	326	Death-associated protein kinase 1; transferase, ca	96.11
2jii_A	352	Serine/threonine-protein kinase VRK3 molecule: VA	96.1
3f3z_A	277	Calcium/calmodulin-dependent protein kinase with d	96.09
2jam_A	304	Calcium/calmodulin-dependent protein kinase type 1	96.08
3soa_A	444	Calcium/calmodulin-dependent protein kinase type a	96.05
2owb_A	335	Serine/threonine-protein kinase PLK1; catalytic do	96.0
3fhr_A	336	MAP kinase-activated protein kinase 3; kinase-inhi	95.95
1opk_A	495	P150, C-ABL, proto-oncogene tyrosine-protein kinas	95.95
1zar_A	282	RIO2 kinase; serine kinase, winged-helix, RIO doma	95.94
2wei_A	287	Calmodulin-domain protein kinase 1, putative; nucl	95.91
3f66_A	298	Hepatocyte growth factor receptor; C-Met, protein	95.88
2j0j_A	656	Focal adhesion kinase 1; cell migration, FERM, tra	95.86
1u5q_A	348	Serine/threonine protein kinase TAO2; transferase;	95.86
3dzo_A	413	Rhoptry kinase domain; parasitic disease, transfer	95.86
3gni_B	389	Strad alpha; kinase fold, pseudokinase, alpha heli	95.8
2bdw_A	362	Hypothetical protein K11E8.1D; kinase, calmodulin	95.77
1fmk_A	452	C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros	95.77
3nyv_A	484	Calmodulin-domain protein kinase 1; serine/threoni	95.76
1xbb_A	291	Tyrosine-protein kinase SYK; gleevec, STI-571, ima	95.73
1u59_A	287	Tyrosine-protein kinase ZAP-70; transferase; HET:	95.63
1t4h_A	290	Serine/threonine-protein kinase WNK1; protein seri	95.61
2h8h_A	535	Proto-oncogene tyrosine-protein kinase SRC; SRC ki	95.59
1zth_A	258	RIO1 serine protein kinase; ribosome biogenesis, r	95.49
3pls_A	298	Macrophage-stimulating protein receptor; protein k	95.49
2pzi_A	681	Probable serine/threonine-protein kinase PKNG; ATP	95.48
1b6c_B	342	TGF-B superfamily receptor type I; complex (isomer	95.44
3lxp_A	318	Non-receptor tyrosine-protein kinase TYK2; JAK3, i	95.4
3c1x_A	373	Hepatocyte growth factor receptor; receptor tyrosi	95.38
2y7j_A	365	Phosphorylase B kinase gamma catalytic chain, test	95.3
3qa8_A	676	MGC80376 protein; kinase ubiquitin-like domain, ph	95.3
2nru_A	307	Interleukin-1 receptor-associated kinase 4; inhibi	94.98
2c30_A	321	Serine/threonine-protein kinase PAK 6; CRIB domain	94.9
4gyi_A	397	RIO2 kinase; protein kinase, ADP complex, phosphoa	94.88
3lm5_A	327	Serine/threonine-protein kinase 17B; STK17B, serin	94.81
3kn6_A	325	Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1	94.8
3rgf_A	405	Cyclin-dependent kinase 8; protein kinase complex,	94.21
2x4f_A	373	Myosin light chain kinase family member 4; LUNG, b	94.02
2ozo_A	613	Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t	93.22
2rio_A	434	Serine/threonine-protein kinase/endoribonuclease I	92.79
3p23_A	432	Serine/threonine-protein kinase/endoribonuclease;	90.97
4fl3_A	635	Tyrosine-protein kinase SYK; transferase; HET: ANP	90.7
3en9_A	540	Glycoprotease, O-sialoglycoprotein endopeptidase/p	86.73
1psb_C	26	NDR Ser/Thr kinase-like protein; helix-loop-helix,	86.71
1l6x_B	34	Minimized B-domain of protein A Z34C; IGG1 FC, FC	81.23

>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A*

Probab=98.07  E-value=2.5e-07  Score=62.34  Aligned_cols=30  Identities=30%  Similarity=0.480  Sum_probs=25.7

Q ss_pred             hhhccCCCCCCCCccccccCCccceEeeec
Q psy17601         34 RLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        34 r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +....+...+||++++.||+|+||+||+|+
T Consensus        15 ~~~~~~~~p~~Y~i~~~lG~G~fg~Vy~a~   44 (304)
T 3ubd_A           15 KEGHEKADPSQFELLKVLGQGSFGKVFLVK   44 (304)
T ss_dssp             CTTCCCCCGGGEEEEEEEECGGGCEEEEEE
T ss_pred             hhccccCCccccEEEEEEecCCCeEEEEEE
Confidence            334556788999999999999999999985

>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A

Probab=97.99  E-value=1e-06  Score=65.50  Aligned_cols=28  Identities=36%  Similarity=0.586  Sum_probs=25.2

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++++||+++++||+|+||+||+|++
T Consensus       183 ~~~~slddf~i~k~LG~G~fG~V~la~~  210 (689)
T 3v5w_A          183 NIHLTMNDFSVHRIIGRGGFGEVYGCRK  210 (689)
T ss_dssp             TCCCCGGGEEEEEEEEECSSEEEEEEEE
T ss_pred             CCCCchHHeEEEEEEecccCeEEEEEEE
Confidence            3478999999999999999999999963

>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens}

Probab=97.92  E-value=3.8e-06  Score=57.89  Aligned_cols=40  Identities=48%  Similarity=0.569  Sum_probs=33.1

Q ss_pred             HHHHHHHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601         24 QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        24 ~~~~~e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....+....+....++..++|++++.||+|+||+||+|.
T Consensus        42 ~~~~~~~~~~~~~~~~~~~~~f~~~~~lG~G~fG~V~~~~   81 (412)
T 2vd5_A           42 FLQWAEPIVVRLKEVRLQRDDFEILKVIGRGAFSEVAVVK   81 (412)
T ss_dssp             HHHHHHHHHHHHHHHSCCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             HHhhhhhhhhhhhhccCChhhEEEEEEEeeCCCeEEEEEE
Confidence            3444556666777778999999999999999999999986

>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ...

Probab=97.91  E-value=1.3e-06  Score=59.18  Aligned_cols=27  Identities=26%  Similarity=0.409  Sum_probs=23.7

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+...+||++++.||+|+||+||+|++
T Consensus        27 ~~~~~~dy~i~~~lG~G~fg~V~~a~~   53 (311)
T 4aw0_A           27 RKKRPEDFKFGKILGEGSFSTVVLARE   53 (311)
T ss_dssp             CCCCGGGEEEEEEEEEETTEEEEEEEE
T ss_pred             CCCCccccEEEEEEecccCeEEEEEEE
Confidence            356679999999999999999999963

>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A*

Probab=97.85  E-value=5e-06  Score=57.30  Aligned_cols=35  Identities=40%  Similarity=0.668  Sum_probs=29.1

Q ss_pred             HHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601         29 ETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        29 e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.........++..++|.+++.||+|+||+||+|.
T Consensus        55 ~~~~~~~~~~~~~~~~y~~~~~LG~G~fG~V~~~~   89 (410)
T 3v8s_A           55 KDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVR   89 (410)
T ss_dssp             HHHHHHHHHHSCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             HHHHHHHHhcccCccccEEEEEEEcCCCEEEEEEE
Confidence            34444556668899999999999999999999986

>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A*

Probab=97.83  E-value=1.2e-06  Score=58.33  Aligned_cols=23  Identities=39%  Similarity=0.853  Sum_probs=18.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++||++++.||+|+||+||+|++
T Consensus         4 l~dy~~~~~lG~G~fg~V~~a~~   26 (299)
T 4g31_A            4 LTDFEPIQCLGRGGFGVVFEAKN   26 (299)
T ss_dssp             HHHEEEEEEEEECC--EEEEEEE
T ss_pred             chhCEEeeEEecCCCeEEEEEEE
Confidence            36899999999999999999963

>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A*

Probab=97.80  E-value=3.5e-06  Score=57.86  Aligned_cols=24  Identities=29%  Similarity=0.531  Sum_probs=15.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++++|++++.||+|+||+||+|++
T Consensus        22 sme~Y~~~~~lG~G~fg~V~~a~~   45 (350)
T 4b9d_A           22 SMEKYVRLQKIGEGSFGKAILVKS   45 (350)
T ss_dssp             CCCCEEEEEEC------CEEEEEE
T ss_pred             cccceEEeEEEecCCCeEEEEEEE
Confidence            568999999999999999999964

>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A

Probab=97.73  E-value=7.2e-06  Score=54.43  Aligned_cols=24  Identities=21%  Similarity=0.573  Sum_probs=16.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|++++.||+|+||+||+|.+
T Consensus        11 ~ig~Y~i~~~lG~G~fg~V~~~~~   34 (275)
T 3hyh_A           11 HIGNYQIVKTLGEGSFGKVKLAYH   34 (275)
T ss_dssp             ---CCEEEEEEEC---CCEEEEEC
T ss_pred             EeeCeEEEEEEecCcCeEEEEEEE
Confidence            367999999999999999999974

>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ...

Probab=97.70  E-value=2.9e-05  Score=51.08  Aligned_cols=53  Identities=30%  Similarity=0.340  Sum_probs=37.6

Q ss_pred             HHHhcCCCCHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCccccccCCccceEeeecC
Q psy17601          6 ESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus         6 ~~l~~~~l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++..+.++....+...+...      .....+..++|.+++.||+|+||.||+|.+
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~   54 (360)
T 3eqc_A            2 KKLEELELDEQQRKRLEAFLTQK------QKVGELKDDDFEKISELGAGNGGVVFKVSH   54 (360)
T ss_dssp             ----CCCCCHHHHHHHHHHHHHH------HTCCCCCGGGEEEEEEEEECSSCEEEEEEE
T ss_pred             CchhhhhhhhhhhhhHHHHhhhh------hcccccccccceeeeeecCCCCeEEEEEEE
Confidence            35778888888766666554432      234467788999999999999999999863

>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ...

Probab=97.62  E-value=8.6e-06  Score=54.41  Aligned_cols=25  Identities=32%  Similarity=0.687  Sum_probs=22.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++++++|++++.||+|+||+||+|.
T Consensus         1 ~~~~~~y~~~~~lG~G~fg~V~~~~   25 (337)
T 1o6l_A            1 KVTMNDFDYLKLLGKGTFGKVILVR   25 (337)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             CCChHHeEEEEEEecCCCeEEEEEE
Confidence            4678999999999999999999986

>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens}

Probab=97.62  E-value=9.3e-06  Score=56.13  Aligned_cols=22  Identities=27%  Similarity=0.646  Sum_probs=20.2

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||+||+|++
T Consensus        54 ~~Y~~~~~lG~G~fG~V~~a~~   75 (398)
T 4b99_A           54 DEYEIIETIGNGAYGVVSSARR   75 (398)
T ss_dssp             SSEEEEEEEEECSSCEEEEEEE
T ss_pred             CCeEEEEEEecccCeEEEEEEE
Confidence            5799999999999999999974

>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A*

Probab=97.56  E-value=1.5e-05  Score=54.01  Aligned_cols=27  Identities=37%  Similarity=0.555  Sum_probs=24.1

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....+++|+++++||+|+||+||+|.
T Consensus        32 ~~~~~~~~y~~~~~lG~G~fg~V~~~~   58 (373)
T 2r5t_A           32 NPHAKPSDFHFLKVIGKGSFGKVLLAR   58 (373)
T ss_dssp             CTTCCGGGEEEEEEEECCTTCEEEEEE
T ss_pred             CCCCChhheEEEEEEeeCCCeEEEEEE
Confidence            346778999999999999999999986

>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A*

Probab=97.54  E-value=1.1e-05  Score=54.29  Aligned_cols=28  Identities=36%  Similarity=0.659  Sum_probs=21.6

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++.+++|+++++||+|+||+||+|.+
T Consensus        14 ~~~~~~~~y~~~~~lG~G~fg~V~~~~~   41 (353)
T 2i0e_A           14 RDRMKLTDFNFLMVLGKGSFGKVMLSER   41 (353)
T ss_dssp             -----CTTEEEEEEEEEETTEEEEEEEE
T ss_pred             cCCCchHHcEEEEEEeeCCCEEEEEEEE
Confidence            3467899999999999999999999863

>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A*

Probab=97.54  E-value=3.9e-05  Score=53.27  Aligned_cols=30  Identities=60%  Similarity=0.847  Sum_probs=26.1

Q ss_pred             hhhccCCCCCCCCccccccCCccceEeeec
Q psy17601         34 RLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        34 r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +....++..++|++++.||+|+||+||+|.
T Consensus        65 ~~~~~~~~~~~y~~~~~LG~G~fG~V~~~~   94 (437)
T 4aw2_A           65 KVKQMRLHREDFEILKVIGRGAFGEVAVVK   94 (437)
T ss_dssp             HHHHHSCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             hhhcccCChhheEEEEEEEeCCCEEEEEEE
Confidence            345557888999999999999999999986

>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens}

Probab=97.52  E-value=1.2e-05  Score=54.05  Aligned_cols=27  Identities=37%  Similarity=0.827  Sum_probs=20.4

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++.+++|++++.||+|+||+||+|.
T Consensus        17 ~~~~~~~~y~~~~~lG~G~fg~V~~~~   43 (353)
T 3txo_A           17 SNRLGIDNFEFIRVLGKGSFGKVMLAR   43 (353)
T ss_dssp             ------CCEEEEEEEEEETTEEEEEEE
T ss_pred             cCCCchhheEEEEEEeeCCCEEEEEEE
Confidence            446788999999999999999999986

>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7

Probab=97.52  E-value=1.4e-05  Score=52.75  Aligned_cols=25  Identities=28%  Similarity=0.631  Sum_probs=22.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++++++|.+++.||+|+||+||+|.
T Consensus         2 ~~~~~~y~~~~~lG~G~~g~V~~~~   26 (318)
T 1fot_A            2 KYSLQDFQILRTLGTGSFGRVHLIR   26 (318)
T ss_dssp             -CCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             CCChHHcEEEEEEeeCCCEEEEEEE
Confidence            4678999999999999999999986

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A

Probab=97.51  E-value=2e-05  Score=57.31  Aligned_cols=28  Identities=36%  Similarity=0.659  Sum_probs=21.6

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++.+++|++++.||+|+||+||+|.+
T Consensus       335 ~~~~~~~~f~~~~~LG~G~fG~V~~~~~  362 (674)
T 3pfq_A          335 RDRMKLTDFNFLMVLGKGSFGKVMLSER  362 (674)
T ss_dssp             -----CTTEEEEEESSBTTTBCEEEEEE
T ss_pred             cccccccceEEEEEEccCCCEEEEEEEE
Confidence            3467889999999999999999999863

>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A*

Probab=97.49  E-value=1.9e-05  Score=53.72  Aligned_cols=21  Identities=24%  Similarity=0.306  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++++.||+|+||+||+|.
T Consensus        21 ~~Y~i~~~lG~G~fg~Vy~a~   41 (361)
T 4f9c_A           21 NVFKIEDKIGEGTFSSVYLAT   41 (361)
T ss_dssp             GTCEEEEEEEECSSEEEEEEE
T ss_pred             CcEEEEEEEecccCcEEEEEE
Confidence            569999999999999999995

>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ...

Probab=97.48  E-value=5.5e-05  Score=50.60  Aligned_cols=27  Identities=22%  Similarity=0.529  Sum_probs=23.9

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....+++|.+++.||+|+||.||+|.
T Consensus        35 ~~~~~~~~y~~~~~lG~G~~g~V~~~~   61 (350)
T 1rdq_E           35 QNTAQLDQFDRIKTLGTGSFGRVMLVK   61 (350)
T ss_dssp             CCCCCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             ccCCCHHHCEEEEEeecCcCcEEEEEE
Confidence            345678999999999999999999986

>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A*

Probab=97.47  E-value=2.1e-05  Score=52.79  Aligned_cols=27  Identities=33%  Similarity=0.583  Sum_probs=21.2

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++.+++|.++++||+|+||+||+|.
T Consensus        11 ~~~~~~~~y~~~~~lG~G~fg~V~~~~   37 (345)
T 1xjd_A           11 QIKLKIEDFILHKMLGKGSFGKVFLAE   37 (345)
T ss_dssp             -----CTTEEEEEEEEECSSSEEEEEE
T ss_pred             cCCCChHHeEEEEEEeeCCCeEEEEEE
Confidence            346788999999999999999999986

>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus}

Probab=97.47  E-value=1.8e-05  Score=54.40  Aligned_cols=26  Identities=42%  Similarity=0.764  Sum_probs=22.8

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+.+++|+++++||+|+||+||+|.
T Consensus        47 ~~~~~~~y~~~~~LG~G~fG~V~~~~   72 (396)
T 4dc2_A           47 SSLGLQDFDLLRVIGRGSYAKVLLVR   72 (396)
T ss_dssp             --CCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             cCCChhHcEEEEEEeeCCCeEEEEEE
Confidence            46788999999999999999999986

>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens}

Probab=97.44  E-value=6.3e-05  Score=50.56  Aligned_cols=24  Identities=25%  Similarity=0.353  Sum_probs=21.8

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||+||+|.
T Consensus        33 i~~~~l~l~~~iG~G~fG~Vy~~~   56 (307)
T 3omv_A           33 IEASEVMLSTRIGSGSFGTVYKGK   56 (307)
T ss_dssp             CCTTSCCEEEECCCCSSSEEEEEE
T ss_pred             EcHHHeEEeeEEeeCCCcEEEEEE
Confidence            567899999999999999999985

>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A*

Probab=97.43  E-value=2.1e-05  Score=53.69  Aligned_cols=24  Identities=29%  Similarity=0.439  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||+||+|.
T Consensus        61 i~~~~~~l~~~LG~G~fG~Vy~a~   84 (353)
T 4ase_A           61 FPRDRLKLGKPLGRGAFGQVIEAD   84 (353)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ecHHHeEEeeEEecCCCeEEEEEE
Confidence            456789999999999999999985

>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens}

Probab=97.42  E-value=2.8e-05  Score=53.16  Aligned_cols=27  Identities=30%  Similarity=0.586  Sum_probs=24.3

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+++++|.+++.||+|+||.||+|.
T Consensus         9 ~~~v~~~~y~i~~~LG~G~fG~V~~~~   35 (384)
T 4fr4_A            9 NEDVNFDHFEILRAIGKGSFGKVCIVQ   35 (384)
T ss_dssp             CCCCCGGGEEEEEEEECCTTCCEEEEE
T ss_pred             CCCCChHHeEEEEEEeeCCCeEEEEEE
Confidence            346788999999999999999999986

>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A*

Probab=97.42  E-value=2.4e-05  Score=52.18  Aligned_cols=26  Identities=38%  Similarity=0.733  Sum_probs=23.7

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++.+++|.+++.||+|+||+||+|.
T Consensus         4 ~~~~~~~y~~~~~lG~G~fg~V~~~~   29 (345)
T 3a8x_A            4 DPLGLQDFDLLRVIGRGSYAKVLLVR   29 (345)
T ss_dssp             CCCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             CCCchhheEEEEEEEecCCeEEEEEE
Confidence            35788999999999999999999986

>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A*

Probab=97.36  E-value=3.6e-05  Score=51.29  Aligned_cols=25  Identities=20%  Similarity=0.308  Sum_probs=20.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..+||.+.+.||+|+||+||+|.
T Consensus         9 ~I~r~~~~l~~~lG~G~fG~Vy~a~   33 (299)
T 4asz_A            9 HIKRHNIVLKRELGEGAFGKVFLAE   33 (299)
T ss_dssp             BCCGGGEEEEEEEEC--CCCEEEEE
T ss_pred             ccCHHHeEEeeEEeeCCCcEEEEEE
Confidence            4667899999999999999999985

>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ...

Probab=97.31  E-value=3.8e-05  Score=48.67  Aligned_cols=27  Identities=30%  Similarity=0.534  Sum_probs=24.3

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++.+++|.+.+.||+|+||.||+|.+
T Consensus         4 ~~~~~~~y~~~~~lg~G~~g~V~~~~~   30 (279)
T 3fdn_A            4 RQWALEDFEIGRPLGKGKFGNVYLARE   30 (279)
T ss_dssp             CCCCGGGEEEEEEEEECSSEEEEEEEE
T ss_pred             ceeecccEEEeeEEecCCCeEEEEEEE
Confidence            467899999999999999999999853

>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A

Probab=97.30  E-value=4.8e-05  Score=50.87  Aligned_cols=26  Identities=15%  Similarity=0.323  Sum_probs=22.6

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+..+++.+++.||+|+||+||+|.
T Consensus        21 ~ei~~~~~~~~~~lG~G~fG~Vykg~   46 (308)
T 4gt4_A           21 KEISLSAVRFMEELGEDRFGKVYKGH   46 (308)
T ss_dssp             CBCCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             ccCCHHHCeEeeEeccCCCcEEEEEE
Confidence            34677889999999999999999974

>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A*

Probab=97.29  E-value=4e-05  Score=52.54  Aligned_cols=22  Identities=18%  Similarity=0.164  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||+||+|.+
T Consensus        74 ~~y~~~~~iG~G~fG~V~~a~~   95 (346)
T 4fih_A           74 SYLDNFIKIGEGSTGIVCIATV   95 (346)
T ss_dssp             GTEEEEEEEEECSSCEEEEEEE
T ss_pred             HhcEEeEEeecCcCeEEEEEEE
Confidence            5799999999999999999964

>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A*

Probab=97.21  E-value=4e-05  Score=52.30  Aligned_cols=24  Identities=33%  Similarity=0.502  Sum_probs=20.0

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+.+.||+|+||+||+|++
T Consensus        56 ~~~~~~~~~~lG~G~fG~Vy~a~~   79 (336)
T 4g3f_A           56 EVHWMTHQPRVGRGSFGEVHRMKD   79 (336)
T ss_dssp             TTTEEEEEEEEEEETTEEEEEEEE
T ss_pred             chhheEeCcEeccCCCeEEEEEEE
Confidence            345677888899999999999964

>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A*

Probab=97.20  E-value=8.9e-05  Score=48.30  Aligned_cols=25  Identities=32%  Similarity=0.602  Sum_probs=22.6

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus         9 ~~~~~~y~~~~~lG~G~~g~Vy~~~   33 (325)
T 3kex_A            9 IFKETELRKLKVLGSGVFGTVHKGV   33 (325)
T ss_dssp             BCCTTTEEEEEEEECCSSCEEEEEE
T ss_pred             hcCHhHceeeeeeeecCCceEEEEE
Confidence            4667899999999999999999986

>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens}

Probab=97.20  E-value=5.7e-05  Score=53.08  Aligned_cols=22  Identities=18%  Similarity=0.164  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||.||+|.+
T Consensus       151 ~~y~~~~~iG~G~fG~V~~a~~  172 (423)
T 4fie_A          151 SYLDNFIKIGEGSTGIVCIATV  172 (423)
T ss_dssp             GTEEEEEEEEECSSCEEEEEEE
T ss_pred             HhcEeeeEeccCcCcEEEEEEE
Confidence            5799999999999999999964

>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A

Probab=97.20  E-value=4.3e-05  Score=54.81  Aligned_cols=23  Identities=22%  Similarity=0.572  Sum_probs=20.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||.||+|.+
T Consensus       156 l~~Y~i~~~lG~G~fg~V~~~~~  178 (573)
T 3uto_A          156 LDHYDIHEELGTGAFGVVHRVTE  178 (573)
T ss_dssp             GGTEEEEEEEEEETTEEEEEEEE
T ss_pred             ccccEEEEEEeeccCeEEEEEEE
Confidence            47899999999999999999863

>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A

Probab=97.17  E-value=6.6e-05  Score=47.50  Aligned_cols=26  Identities=35%  Similarity=0.686  Sum_probs=23.0

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..++|.+++.||+|+||.||+|.+
T Consensus         3 ~i~~~~y~~~~~lg~G~~g~V~~~~~   28 (290)
T 3fme_A            3 EVKADDLEPIMELGRGAYGVVEKMRH   28 (290)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEEE
T ss_pred             cccHHhhhhHHhcCCCCCeEEEEEEe
Confidence            45678999999999999999999863

>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A

Probab=97.16  E-value=7.6e-05  Score=47.66  Aligned_cols=23  Identities=30%  Similarity=0.642  Sum_probs=20.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+++.||+|+||.||+|.+
T Consensus         1 l~~y~~~~~lg~G~~g~V~~~~~   23 (292)
T 3o0g_A            1 MQKYEKLEKIGEGTYGTVFKAKN   23 (292)
T ss_dssp             CCSEEEEEEEEECSSSEEEEEEE
T ss_pred             CCCceeeeEecCCCCeEEEEEEE
Confidence            46899999999999999999863

>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens}

Probab=97.12  E-value=0.0001  Score=47.75  Aligned_cols=26  Identities=31%  Similarity=0.630  Sum_probs=23.2

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+.+++|.+++.||+|+||.||+|.
T Consensus         8 ~~~~~~~y~~~~~lg~G~~g~Vy~~~   33 (336)
T 3g2f_A            8 PSLDLDNLKLLELIGRGRYGAVYKGS   33 (336)
T ss_dssp             -CCCTTSEEEEEEEEECSSEEEEEEE
T ss_pred             CCcChHHhheeeecccCCCeEEEEEE
Confidence            46788999999999999999999985

>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A*

Probab=97.12  E-value=0.00014  Score=46.12  Aligned_cols=31  Identities=29%  Similarity=0.353  Sum_probs=24.6

Q ss_pred             hhhccCCCCCCCCccccccCCccceEeeecC
Q psy17601         34 RLKRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        34 r~~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ......+..++|.+.+.||+|+||.||+|.+
T Consensus        10 ~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~   40 (287)
T 4f0f_A           10 KSRLPTLADNEIEYEKQIGKGGFGLVHKGRL   40 (287)
T ss_dssp             --CCCBCCSTTEEEEEECCCCSSSCEEEEEE
T ss_pred             chhhhhhhhccceehhccccCCceeEEEEEE
Confidence            3344456778999999999999999999863

>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B

Probab=97.12  E-value=0.00012  Score=52.42  Aligned_cols=27  Identities=33%  Similarity=0.554  Sum_probs=24.6

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+..++|.++++||+|+||+||+|.
T Consensus       179 ~~~~~~~~f~~~~~LG~G~fG~Vy~a~  205 (543)
T 3c4z_A          179 AQPMGEDWFLDFRVLGRGGFGEVFACQ  205 (543)
T ss_dssp             TSCCCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             cccCChhheEEEEEEeeCCCeEEEEEE
Confidence            356888999999999999999999986

>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens}

Probab=97.11  E-value=9e-05  Score=49.94  Aligned_cols=26  Identities=23%  Similarity=0.247  Sum_probs=22.5

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+..+||.+.+.||+|+||+||+|.
T Consensus        36 ~~i~~~d~~l~~~LG~G~fG~Vy~a~   61 (329)
T 4aoj_A           36 HHIKRRDIVLKWELGEGAFGKVFLAE   61 (329)
T ss_dssp             CBCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             cccCHHHeEEEEEEccCCCcEEEEEE
Confidence            35677899999999999999999984

>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7

Probab=97.11  E-value=7.8e-05  Score=49.52  Aligned_cols=25  Identities=44%  Similarity=0.800  Sum_probs=22.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.+++|.+++.||+|+||.||+|.
T Consensus        50 ~~~~~~y~~~~~lG~G~~g~Vy~~~   74 (355)
T 1vzo_A           50 KVGIENFELLKVLGTGAYGKVFLVR   74 (355)
T ss_dssp             CCCGGGEEEEEEEEETTTEEEEEEE
T ss_pred             cccccceEEEEEeccCCCEEEEEEE
Confidence            4567899999999999999999985

>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens}

Probab=97.08  E-value=0.00017  Score=46.33  Aligned_cols=25  Identities=36%  Similarity=0.670  Sum_probs=19.8

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|.+++.||+|+||.||+|.+
T Consensus         6 ~~~~~y~~~~~lg~G~~g~V~~~~~   30 (308)
T 3g33_A            6 MATSRYEPVAEIGVGAYGTVYKARD   30 (308)
T ss_dssp             ----CCEEEEEECCSSSCCEEEEEC
T ss_pred             ccccceEEEEEEecCCCeEEEEEEE
Confidence            3457899999999999999999974

>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A*

Probab=97.07  E-value=7.1e-05  Score=49.09  Aligned_cols=27  Identities=30%  Similarity=0.575  Sum_probs=23.1

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+..++|++++.||+|+||.||+|.
T Consensus        11 ~~~~~~~~y~~~~~lG~G~~g~V~~~~   37 (327)
T 3a62_A           11 PEKIRPECFELLRVLGKGGYGKVFQVR   37 (327)
T ss_dssp             --CCCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             CCCCCHHHeEEEEEEEeCCCEEEEEEE
Confidence            346788999999999999999999985

>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens}

Probab=97.07  E-value=8.9e-05  Score=47.47  Aligned_cols=25  Identities=16%  Similarity=0.380  Sum_probs=20.0

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.+++|.+.+.||+|+||.||+|.
T Consensus         9 ~~~~~~y~~~~~lG~G~~g~Vy~a~   33 (298)
T 2zv2_A            9 CVQLNQYTLKDEIGKGSYGVVKLAY   33 (298)
T ss_dssp             -CEETTEEEEEEEEC--CCEEEEEE
T ss_pred             ceeecceEEEeEEeecCCEEEEEEE
Confidence            3567899999999999999999985

>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A

Probab=97.06  E-value=0.00013  Score=48.90  Aligned_cols=24  Identities=21%  Similarity=0.336  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus        78 ~~~~~~~~~~~LG~G~fg~Vy~a~  101 (370)
T 2psq_A           78 FPRDKLTLGKPLGEGCFGQVVMAE  101 (370)
T ss_dssp             CCGGGEEEEEEESCCSSSEEEEEE
T ss_pred             ccHHHCEeeeEEeeCCCeeEEEEE
Confidence            456789999999999999999985

>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A*

Probab=97.05  E-value=0.00012  Score=53.08  Aligned_cols=28  Identities=29%  Similarity=0.555  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeec
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.++..++|.++++||+|+||+||+|.
T Consensus       177 ~~~~~~~~~f~~~~~LG~G~fG~Vy~a~  204 (576)
T 2acx_A          177 ERQPVTKNTFRQYRVLGKGGFGEVCACQ  204 (576)
T ss_dssp             HTSCCCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             hhcCccccceEEEEEEeeCCCEEEEEEE
Confidence            4556888999999999999999999986

>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A*

Probab=97.03  E-value=0.00017  Score=46.94  Aligned_cols=24  Identities=21%  Similarity=0.534  Sum_probs=6.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~G~~g~V~~~~~   26 (317)
T 2pmi_A            3 SSSQFKQLEKLGNGTYATVYKGLN   26 (317)
T ss_dssp             ----------------CEEEEEEC
T ss_pred             cccceeEeeEECCCCCEEEEEEEE
Confidence            357899999999999999999864

>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A*

Probab=97.02  E-value=8.4e-05  Score=50.72  Aligned_cols=26  Identities=35%  Similarity=0.673  Sum_probs=22.7

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++..++|.+++.||+|+||.||+|.
T Consensus       143 ~~~~~~~y~~~~~lG~G~~g~V~~~~  168 (446)
T 4ejn_A          143 HRVTMNEFEYLKLLGKGTFGKVILVK  168 (446)
T ss_dssp             -CCCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             cCCChHHcEEeEEEeeCcCEEEEEEE
Confidence            35677899999999999999999986

>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens}

Probab=97.02  E-value=0.00014  Score=47.72  Aligned_cols=25  Identities=40%  Similarity=0.689  Sum_probs=22.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus        11 ~l~~~~y~~~~~lG~G~~g~Vy~~~   35 (327)
T 3lzb_A           11 ILKETEFKKIKVLGSGAFGTVYKGL   35 (327)
T ss_dssp             ECCTTTEEEEEEEEECSSEEEEEEE
T ss_pred             ccCHhHceEEEEeeeCCCeEEEEEE
Confidence            3567899999999999999999986

>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus}

Probab=97.01  E-value=6.2e-05  Score=48.23  Aligned_cols=23  Identities=39%  Similarity=0.849  Sum_probs=19.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||.||+|.+
T Consensus         5 ~~~y~~~~~lG~G~~g~V~~a~~   27 (332)
T 3qd2_B            5 LTDFEPIQCMGRGGFGVVFEAKN   27 (332)
T ss_dssp             HHHEEEEEEEECC-CSEEEEEEE
T ss_pred             hhcCceeeEecCCCCeEEEEEEE
Confidence            35799999999999999999863

>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A

Probab=97.01  E-value=9.5e-05  Score=47.23  Aligned_cols=23  Identities=30%  Similarity=0.596  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+++.||+|+||.||+|.+
T Consensus         1 ~~~y~~~~~lg~G~~g~V~~~~~   23 (288)
T 1ob3_A            1 MEKYHGLEKIGEGTYGVVYKAQN   23 (288)
T ss_dssp             CCSEEEEEEEEEETTEEEEEEEE
T ss_pred             CccchhhhhcccCCCEEEEEEEc
Confidence            46899999999999999999863

>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A*

Probab=97.01  E-value=0.00011  Score=45.74  Aligned_cols=27  Identities=19%  Similarity=0.081  Sum_probs=23.8

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+..++|.+++.||+|+||.||+|.+
T Consensus         5 ~~i~~~~y~~~~~lg~G~~g~V~~~~~   31 (271)
T 3kmu_A            5 SGIDFKQLNFLTKLNENHSGELWKGRW   31 (271)
T ss_dssp             CCCCGGGCEEEEEEEEETTEEEEEEEE
T ss_pred             CCCCHHHhHHHHHhcCCCcceEEEEEE
Confidence            457789999999999999999999863

>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens}

Probab=97.00  E-value=0.00013  Score=47.64  Aligned_cols=23  Identities=22%  Similarity=0.431  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+++.||+|+||.||+|.+
T Consensus         1 l~~y~~~~~lG~G~~g~V~~~~~   23 (324)
T 3mtl_A            1 METYIKLDKLGEGTYATVYKGKS   23 (324)
T ss_dssp             CCSEEEEEEEEECSSEEEEEEEE
T ss_pred             CCceEEEEEEcCCCCEEEEEEEE
Confidence            47899999999999999999863

>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A

Probab=96.97  E-value=0.00012  Score=48.49  Aligned_cols=28  Identities=21%  Similarity=0.427  Sum_probs=23.2

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+..+++|.+++.||+|+||.||+|.+
T Consensus         9 ~~~~~~~~y~~~~~lG~G~~g~V~~a~~   36 (328)
T 3fe3_A            9 DEQPHIGNYRLLKTIGKGNFAKVKLARH   36 (328)
T ss_dssp             --CCEETTEEEEEEEEECSSEEEEEEEE
T ss_pred             ccCCccCCEEEEEEEeeCCCEEEEEEEE
Confidence            3456678999999999999999999863

>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A*

Probab=96.96  E-value=0.00011  Score=48.18  Aligned_cols=24  Identities=33%  Similarity=0.702  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -+++|.+++.||+|+||.||+|.+
T Consensus         5 ~~~~y~i~~~lG~G~~g~V~~~~~   28 (323)
T 3tki_A            5 FVEDWDLVQTLGEGAYGEVQLAVN   28 (323)
T ss_dssp             TTTCEEEEEEEEEETTEEEEEEEE
T ss_pred             HhhhceeeeEEecCCCEEEEEEEE
Confidence            358999999999999999999853

>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii}

Probab=96.94  E-value=0.00015  Score=49.41  Aligned_cols=22  Identities=27%  Similarity=0.616  Sum_probs=13.2

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        53 ~~y~~~~~lG~G~~g~V~~~~~   74 (458)
T 3rp9_A           53 DRYEIRHLIGTGSYGHVCEAYD   74 (458)
T ss_dssp             TTEEECCC-------CEEEEEE
T ss_pred             CCeEEeeEeeecCCeEEEEEEE
Confidence            7899999999999999999863

>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A*

Probab=96.93  E-value=0.00011  Score=47.86  Aligned_cols=25  Identities=28%  Similarity=0.283  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++.++|.+++.||+|+||.||+|.
T Consensus        20 ~~~~~~y~~~~~lg~G~~g~Vy~~~   44 (322)
T 3soc_A           20 YFQSMPLQLLEVKARGRFGCVWKAQ   44 (322)
T ss_dssp             EETTEEEEEEEEEECSTTCEEEEEE
T ss_pred             ccchhhchhhheecccCceEEEEEE
Confidence            3567899999999999999999985

>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=96.90  E-value=0.00016  Score=45.57  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus         6 ~i~~~~y~~~~~lg~G~~g~V~~~~   30 (269)
T 4hcu_A            6 VIDPSELTFVQEIGSGQFGLVHLGY   30 (269)
T ss_dssp             BCCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             EeChhhceeeheecCCCccEEEEEE
Confidence            3567899999999999999999986

>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ...

Probab=96.90  E-value=0.00018  Score=45.69  Aligned_cols=23  Identities=30%  Similarity=0.642  Sum_probs=21.0

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+++.||+|+||.||+|.+
T Consensus         2 ~~~y~~~~~lg~G~~g~V~~~~~   24 (299)
T 2r3i_A            2 MENFQKVEKIGEGTYGVVYKARN   24 (299)
T ss_dssp             CTTEEEEEEEEECSSSEEEEEEE
T ss_pred             cchhhhhhhhccCCCeeEEEEEE
Confidence            68999999999999999999853

>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II}

Probab=96.89  E-value=0.00014  Score=48.51  Aligned_cols=23  Identities=39%  Similarity=0.717  Sum_probs=13.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+++.||+|+||.||+|.+
T Consensus         8 ~~~y~~~~~lG~G~~g~V~~~~~   30 (388)
T 3oz6_A            8 LRKYELVKKLGKGAYGIVWKSID   30 (388)
T ss_dssp             HTTEEEEEC-------CEEEEEE
T ss_pred             cCceEEEEEeeeCCCeEEEEEEE
Confidence            46899999999999999999863

>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A*

Probab=96.88  E-value=0.00015  Score=47.09  Aligned_cols=27  Identities=26%  Similarity=0.429  Sum_probs=23.1

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+--.++|.+++.||+|+||.||+|.+
T Consensus        16 ~q~l~~~y~~~~~lG~G~~g~V~~~~~   42 (311)
T 3niz_A           16 FQGLMEKYQKLEKVGEGTYGVVYKAKD   42 (311)
T ss_dssp             EECSSCEEEEEEEEEECSSCEEEEEEE
T ss_pred             ecchHhhhHhhhhccCCCCeEEEEEEE
Confidence            344568999999999999999999864

>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A*

Probab=96.88  E-value=0.00022  Score=46.30  Aligned_cols=26  Identities=35%  Similarity=0.474  Sum_probs=23.2

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+..++|.+.+.||+|+||.||+|.
T Consensus        20 p~~~~~~y~~~~~lg~G~~g~Vy~~~   45 (327)
T 1fvr_A           20 PVLDWNDIKFQDVIGEGNFGQVLKAR   45 (327)
T ss_dssp             SBCCGGGCEEEEEEECGGGCEEEEEE
T ss_pred             ccccHHHccceeeeecCCCceEEEEE
Confidence            35677899999999999999999986

>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A

Probab=96.88  E-value=0.00022  Score=47.17  Aligned_cols=23  Identities=22%  Similarity=0.209  Sum_probs=19.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+.+.||+|+||.||+|.
T Consensus        33 ~~~~y~~~~~lG~G~~g~Vy~~~   55 (364)
T 3op5_A           33 AAAAWKVGLPIGQGGFGCIYLAD   55 (364)
T ss_dssp             TCCEEEEEEECCCC-CCEEEEEE
T ss_pred             CCCeEEEEEEEecCCCeEEEEee
Confidence            34589999999999999999985

>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A*

Probab=96.88  E-value=0.00018  Score=47.10  Aligned_cols=24  Identities=42%  Similarity=0.650  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||+|+||.||+|.+
T Consensus        15 ~~~~y~~~~~lg~G~~g~V~~~~~   38 (351)
T 3mi9_A           15 EVSKYEKLAKIGQGTFGEVFKARH   38 (351)
T ss_dssp             BGGGEEEEEECSSCSTTSEEEEEE
T ss_pred             cccceeEEEEEecCCCcEEEEEEE
Confidence            468899999999999999999863

>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A*

Probab=96.87  E-value=0.00036  Score=44.21  Aligned_cols=26  Identities=27%  Similarity=0.369  Sum_probs=19.1

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..++|.+.+.||+|+||.||+|.+
T Consensus        11 ~i~~~~y~~~~~lg~G~~g~V~~~~~   36 (303)
T 2vwi_A           11 SINRDDYELQEVIGSGATAVVQAAYC   36 (303)
T ss_dssp             --CCCCCEEEEECC---CCCEEEEEC
T ss_pred             ccchhhhhhhheeccccceEEEEEEE
Confidence            46778999999999999999999864

>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ...

Probab=96.86  E-value=0.00013  Score=47.64  Aligned_cols=25  Identities=40%  Similarity=0.689  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus        11 ~l~~~~y~~~~~lG~G~~g~Vy~~~   35 (327)
T 3poz_A           11 ILKETEFKKIKVLGSGAFGTVYKGL   35 (327)
T ss_dssp             ECCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             hcCHHHcccceEEeeCCCeEEEEEE
Confidence            3566889999999999999999986

>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A

Probab=96.86  E-value=6.5e-05  Score=49.08  Aligned_cols=25  Identities=36%  Similarity=0.583  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|.+++.||+|+||+||+|.+
T Consensus        17 ~~~~~y~~~~~lG~G~~g~V~~~~~   41 (336)
T 2vuw_A           17 LPTEKLQRCEKIGEGVFGEVFQTIA   41 (336)
T ss_dssp             SCHHHHHTCEEEEEETTEEEEEEEE
T ss_pred             cccccchheeeecccCceEEEEEEe
Confidence            4457899999999999999999864

>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A*

Probab=96.86  E-value=0.00014  Score=46.04  Aligned_cols=25  Identities=24%  Similarity=0.385  Sum_probs=22.7

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++..++|.+.+.||+|+||.||+|.
T Consensus         4 ~i~~~~y~~~~~lg~G~~g~V~~~~   28 (289)
T 4fvq_A            4 KIRNEDLIFNESLGQGTFTKIFKGV   28 (289)
T ss_dssp             BCCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             EechhHeeeeeeeccCCCceEEEEE
Confidence            5677899999999999999999985

>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A

Probab=96.86  E-value=0.0002  Score=45.31  Aligned_cols=27  Identities=26%  Similarity=0.356  Sum_probs=20.3

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-.+..++|.+++.||+|+||.||+|.
T Consensus        18 ~~~~~~~~y~~~~~lg~G~~g~V~~~~   44 (283)
T 3gen_A           18 SWEIDPKDLTFLKELGTGQFGVVKYGK   44 (283)
T ss_dssp             TTBCCGGGEEEEEECC---CEEEEEEE
T ss_pred             CccCCHHHHHhHhhcCCCCCceEEEEE
Confidence            335677899999999999999999985

>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens}

Probab=96.85  E-value=0.0003  Score=46.18  Aligned_cols=24  Identities=21%  Similarity=0.250  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .-+.|.+++.||+|+||.||+|.+
T Consensus         7 ~~~~y~i~~~lG~G~~g~Vy~~~~   30 (343)
T 3dbq_A            7 KGRIYSILKQIGSGGSSKVFQVLN   30 (343)
T ss_dssp             SSCEEEEEEEESCCSSEEEEEEEC
T ss_pred             ecCEEEEEEEEecCCCeEEEEEEe
Confidence            446799999999999999999864

>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A*

Probab=96.85  E-value=0.00026  Score=45.83  Aligned_cols=26  Identities=38%  Similarity=0.681  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..++|.+++.||+|+||.||+|.+
T Consensus        18 ~~~~~~y~~~~~lg~G~~g~Vy~~~~   43 (327)
T 3aln_A           18 DFTAEDLKDLGEIGRGAYGSVNKMVH   43 (327)
T ss_dssp             CCCSCSEEC-CEEEECSSEEEEEEEE
T ss_pred             ccCHHHhhehheeccCCCEEEEEEEE
Confidence            56778999999999999999999863

>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ...

Probab=96.85  E-value=0.00019  Score=45.56  Aligned_cols=27  Identities=22%  Similarity=0.556  Sum_probs=23.2

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+.+++|.+.+.||.|+||.||+|.
T Consensus         8 ~~~~~~~~y~~~~~lg~G~~g~Vy~~~   34 (284)
T 2vgo_A            8 KRKFTIDDFDIGRPLGKGKFGNVYLAR   34 (284)
T ss_dssp             --CCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ccchhhhhceeeheecCCCCeEEEEEE
Confidence            346788999999999999999999985

>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A*

Probab=96.84  E-value=0.00056  Score=44.13  Aligned_cols=25  Identities=28%  Similarity=0.646  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ....++|.+.+.||+|+||.||+|.
T Consensus        26 ~~~~~~y~~~~~lg~G~~g~V~~~~   50 (326)
T 3uim_A           26 QVASDNFSNKNILGRGGFGKVYKGR   50 (326)
T ss_dssp             HTTTTSSCSTTEEECCSSSEEEEEC
T ss_pred             HHHhhccccceeEecCCCcEEEEEE
Confidence            4566899999999999999999986

>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A

Probab=96.84  E-value=0.0003  Score=46.95  Aligned_cols=24  Identities=29%  Similarity=0.479  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus        18 ~~~~y~~~~~lG~G~~g~V~~~~~   41 (361)
T 3uc3_A           18 DSDRYDFVKDIGSGNFGVARLMRD   41 (361)
T ss_dssp             CTTTEEEEEEESSSTTSSEEEEEE
T ss_pred             CCCcEEEEEEeccCCCEEEEEEEE
Confidence            457899999999999999999863

>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens}

Probab=96.83  E-value=0.00031  Score=46.88  Aligned_cols=25  Identities=24%  Similarity=0.456  Sum_probs=21.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus        67 ~~~~~~~~~~~~LG~G~fg~Vy~~~   91 (367)
T 3l9p_A           67 EVPRKNITLIRGLGHGAFGEVYEGQ   91 (367)
T ss_dssp             BCCGGGEEEEEECCCCSSSCEEEEE
T ss_pred             hcCHhHeEEeeEeeeCCCEEEEEEE
Confidence            4556789999999999999999986

>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major}

Probab=96.83  E-value=0.00015  Score=47.36  Aligned_cols=25  Identities=20%  Similarity=0.464  Sum_probs=11.9

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|.+.+.||+|+||.||+|.+
T Consensus        20 ~~~~~y~~~~~lg~G~~g~V~~~~~   44 (360)
T 3e3p_A           20 KEMDRFQVERMAGQGTFGTVQLGKE   44 (360)
T ss_dssp             HHHTTEEEC----------CEEEEE
T ss_pred             hhccceEEEEEEecCCCeEEEEEEE
Confidence            4467899999999999999999863

>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens}

Probab=96.82  E-value=0.00022  Score=45.71  Aligned_cols=23  Identities=30%  Similarity=0.562  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+++.||+|+||.||+|.+
T Consensus         2 ~~~y~~~~~lg~G~~g~V~~~~~   24 (311)
T 4agu_A            2 MEKYEKIGKIGEGSYGVVFKCRN   24 (311)
T ss_dssp             -CCEEEEEEEEECSSEEEEEEEE
T ss_pred             cccceEeeEEeecCCeEEEEEEe
Confidence            46899999999999999999863

>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II}

Probab=96.82  E-value=0.00024  Score=47.39  Aligned_cols=24  Identities=25%  Similarity=0.457  Sum_probs=19.7

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus         5 ~~~~y~~~~~lG~G~fg~V~~a~~   28 (383)
T 3eb0_A            5 SSKKYSLGKTLGTGSFGIVCEVFD   28 (383)
T ss_dssp             -CTTEEEEEEEECC-CEEEEEEEE
T ss_pred             ccceEEEEEEEEeccCEEEEEEEE
Confidence            456899999999999999999863

>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens}

Probab=96.82  E-value=0.00037  Score=44.38  Aligned_cols=23  Identities=17%  Similarity=0.543  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+.+.||+|+||.||+|.+
T Consensus         4 ~~~y~i~~~lg~G~~g~V~~~~~   26 (305)
T 2wtk_C            4 IGKYLMGDLLGEGSYGKVKEVLD   26 (305)
T ss_dssp             -CCBCCCCEEEECSSCEEEEEEB
T ss_pred             ccceeEeeEEecCCCeEEEEEEE
Confidence            47899999999999999999864

>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7}

Probab=96.80  E-value=0.00022  Score=46.72  Aligned_cols=24  Identities=21%  Similarity=0.300  Sum_probs=21.1

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.++|.+++.||+|+||.||+|.+
T Consensus        33 ~~~~y~~~~~lG~G~~g~V~~~~~   56 (360)
T 3llt_A           33 LNNAFLVIRKMGDGTFGRVLLCQH   56 (360)
T ss_dssp             ETTTEEEEEEEEECSSEEEEEEEE
T ss_pred             ecCEEEEEEEEcccCCeEEEEEEE
Confidence            347899999999999999999863

>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A*

Probab=96.79  E-value=0.00025  Score=45.77  Aligned_cols=24  Identities=25%  Similarity=0.454  Sum_probs=21.1

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus        18 ~~~~y~~~~~lg~G~~g~V~~~~~   41 (297)
T 3fxz_A           18 PKKKYTRFEKIGQGASGTVYTAMD   41 (297)
T ss_dssp             GGGTBCCCEEEEEETTEEEEEEEB
T ss_pred             hhhceeeeeeeccCCCeEEEEEEE
Confidence            446899999999999999999963

>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A*

Probab=96.79  E-value=0.00022  Score=45.28  Aligned_cols=25  Identities=32%  Similarity=0.549  Sum_probs=21.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        11 ~~~~~~y~~~~~lg~G~~g~Vy~~~   35 (281)
T 1mp8_A           11 EIQRERIELGRCIGEGQFGDVHQGI   35 (281)
T ss_dssp             BCCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             EEehHHeEEEeEeeecCCeeEEEEE
Confidence            4566789999999999999999985

>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens}

Probab=96.79  E-value=0.00022  Score=46.67  Aligned_cols=26  Identities=23%  Similarity=0.257  Sum_probs=23.0

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+..++|.+.+.||+|+||.||+|.
T Consensus        44 ~~~~~~~y~i~~~lG~G~~g~V~~~~   69 (325)
T 3kul_A           44 REIEASRIHIEKIIGSGDSGEVCYGR   69 (325)
T ss_dssp             CBCCGGGEEEEEEEEETTTEEEEEEE
T ss_pred             cccChhHeEEeeEEEeCCCcEEEEEE
Confidence            35677899999999999999999986

>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A*

Probab=96.79  E-value=0.00027  Score=44.86  Aligned_cols=25  Identities=28%  Similarity=0.502  Sum_probs=21.8

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.-.++|.+++.||+|+||.||+|.
T Consensus         4 ~~~~~~y~~~~~lg~G~~g~V~~~~   28 (301)
T 3q4u_A            4 RTVARDITLLECVGKGRYGEVWRGS   28 (301)
T ss_dssp             CCCGGGCEEEEEEEECSSEEEEEEE
T ss_pred             ccccCcEEEEEeeccCCCcEEEEEE
Confidence            3456799999999999999999985

>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens}

Probab=96.79  E-value=0.0006  Score=43.66  Aligned_cols=28  Identities=25%  Similarity=0.409  Sum_probs=24.3

Q ss_pred             hccCCCCCCCCccccccCCccceEeeec
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..-.+..++|.+.+.||+|+||.||+|.
T Consensus        26 ~~~~i~~~~~~~~~~lg~G~~g~V~~~~   53 (319)
T 2y4i_B           26 QEWDIPFEQLEIGELIGKGRFGQVYHGR   53 (319)
T ss_dssp             GGSSSCCSCEECCCBCCCSSSSEEEEEE
T ss_pred             ccccCCHHHeEEeeEeccCCceEEEEEE
Confidence            4446778999999999999999999985

>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A*

Probab=96.78  E-value=0.00023  Score=49.40  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|++
T Consensus        61 ~~~y~~~~~lG~G~~g~V~~a~~   83 (464)
T 3ttj_A           61 LKRYQNLKPIGSGAQGIVCAAYD   83 (464)
T ss_dssp             ETTEEEEEEEEECSSCEEEEEEE
T ss_pred             cCCeEEEEEeecCCCeEEEEEEE
Confidence            47899999999999999999963

>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A*

Probab=96.78  E-value=0.00067  Score=43.85  Aligned_cols=24  Identities=29%  Similarity=0.548  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+.+.||+|+||.||+|.+
T Consensus        37 ~~~~y~~~~~lg~G~~g~Vy~~~~   60 (321)
T 2qkw_B           37 ATNNFDHKFLIGHGVFGKVYKGVL   60 (321)
T ss_dssp             CCCCCSCCCCSCBCSSSEEEEEEC
T ss_pred             HHhccCccceeecCCCeeEEEEEE
Confidence            457999999999999999999863

>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7

Probab=96.78  E-value=0.00028  Score=45.68  Aligned_cols=26  Identities=27%  Similarity=0.383  Sum_probs=23.1

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+..++|.+++.||+|+||.||+|.
T Consensus        42 ~~~~~~~~~~~~~lg~G~~g~Vy~~~   67 (343)
T 1luf_A           42 LEYPRNNIEYVRDIGEGAFGRVFQAR   67 (343)
T ss_dssp             TBCCGGGCEEEEEEEECSSCEEEEEE
T ss_pred             eEecHHHCeeeeeeeecCCeeEEEEE
Confidence            35667899999999999999999986

>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A*

Probab=96.78  E-value=0.00024  Score=46.63  Aligned_cols=23  Identities=17%  Similarity=0.306  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|++
T Consensus        36 ~~~y~~~~~lg~G~~g~V~~~~~   58 (397)
T 1wak_A           36 NGRYHVIRKLGWGHFSTVWLSWD   58 (397)
T ss_dssp             TTTEEEEEEEEECSSEEEEEEEE
T ss_pred             CCeEEEEEEeeecCCeeEEEEEe
Confidence            36799999999999999999963

>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens}

Probab=96.77  E-value=0.00021  Score=45.98  Aligned_cols=25  Identities=28%  Similarity=0.484  Sum_probs=22.1

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|.+.+.||+|+||.||+|.+
T Consensus         7 ~~~~~~~~~~~lG~G~~g~V~~~~~   31 (310)
T 3s95_A            7 FRPSDLIHGEVLGKGCFGQAIKVTH   31 (310)
T ss_dssp             ECGGGEEEEEEEECCSSEEEEEEEE
T ss_pred             eChhHeeccceecCCCCEEEEEEEE
Confidence            4578999999999999999999863

>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A*

Probab=96.76  E-value=0.0002  Score=46.59  Aligned_cols=25  Identities=28%  Similarity=0.565  Sum_probs=22.0

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|.+++.||+|+||.||+|.+
T Consensus        22 ~~~~~y~~~~~lg~G~~g~V~~~~~   46 (331)
T 4aaa_A           22 QSMEKYENLGLVGEGSYGMVMKCRN   46 (331)
T ss_dssp             BCGGGEEEEEEGGGGTTSSEEEEEE
T ss_pred             hhhhhheeeeEEeecCCEEEEEEEE
Confidence            3568999999999999999999863

>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ...

Probab=96.76  E-value=0.00024  Score=46.27  Aligned_cols=25  Identities=24%  Similarity=0.353  Sum_probs=22.0

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        31 ~~~~~~y~~~~~lG~G~~g~Vy~~~   55 (334)
T 2pvf_A           31 EFPRDKLTLGKPLGEGAFGQVVMAE   55 (334)
T ss_dssp             BCCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             cCCHhHeEEeeEEeecCceeEEEeE
Confidence            4456899999999999999999985

>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe}

Probab=96.75  E-value=0.00018  Score=48.01  Aligned_cols=26  Identities=15%  Similarity=0.367  Sum_probs=22.6

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+++|.+.+.||+|+||.||+|.+
T Consensus         5 ~~~i~~Y~i~~~lG~G~~g~V~~a~~   30 (336)
T 3h4j_B            5 KRHIGPYIIRETLGEGSFGKVKLATH   30 (336)
T ss_dssp             CSEETTEEEEEEEEEETTEEEEEEEE
T ss_pred             ccccCCEEEEEEEecCCCeEEEEEEE
Confidence            34568999999999999999999863

>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0

Probab=96.74  E-value=0.00025  Score=44.47  Aligned_cols=25  Identities=20%  Similarity=0.501  Sum_probs=22.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~~lg~G~~g~V~~~~   27 (271)
T 3dtc_A            3 EIDFAELTLEEIIGIGGFGKVYRAF   27 (271)
T ss_dssp             BCCTTSEEEEEEEEEETTEEEEEEE
T ss_pred             ccchhheeeeeeeccCCCeEEEEEE
Confidence            3567899999999999999999985

>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A*

Probab=96.74  E-value=0.00031  Score=45.68  Aligned_cols=21  Identities=38%  Similarity=0.455  Sum_probs=18.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||+|.
T Consensus         9 ~~y~~~~~lg~G~~g~V~~~~   29 (330)
T 2izr_A            9 PNFRVGKKIGCGNFGELRLGK   29 (330)
T ss_dssp             TTEEEEEECCC-CTTSEEEEE
T ss_pred             CCeEEEEEeeccCCceEEEEE
Confidence            689999999999999999986

>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ...

Probab=96.73  E-value=0.00031  Score=44.75  Aligned_cols=25  Identities=20%  Similarity=0.402  Sum_probs=22.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus         6 ~~~~~~~~~~~~lg~G~~g~V~~~~   30 (295)
T 3ugc_A            6 QFEERHLKFLQQLGKGNFGSVEMCR   30 (295)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             cCCHHHhhhhheeeccCCEEEEEEE
Confidence            5667899999999999999999985

>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A*

Probab=96.73  E-value=0.00022  Score=47.08  Aligned_cols=21  Identities=29%  Similarity=0.427  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++.+.+.||+|+||+||+|.
T Consensus         3 r~i~L~~~iG~G~fG~Vy~~~   23 (303)
T 3hmm_A            3 RTIVLQESIGKGRFGEVWRGK   23 (303)
T ss_dssp             GGEEEEEEEEECSSSEEEEEE
T ss_pred             cEEEEEEEEeeCCCeEEEEEE
Confidence            356677899999999999985

>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ...

Probab=96.73  E-value=0.00022  Score=46.07  Aligned_cols=23  Identities=26%  Similarity=0.638  Sum_probs=20.9

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++|.+++.||+|+||.||+|.
T Consensus        34 ~~~~y~~~~~lg~G~~g~V~~~~   56 (330)
T 3nsz_A           34 NQDDYQLVRKLGRGKYSEVFEAI   56 (330)
T ss_dssp             EGGGEEEEEEEEECSSEEEEEEE
T ss_pred             CCCceEEEEEecccCCeEEEEEE
Confidence            45789999999999999999985

>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens}

Probab=96.72  E-value=0.00034  Score=45.29  Aligned_cols=25  Identities=36%  Similarity=0.551  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++.++|++.+.||+|+||.||+|.
T Consensus         4 ~i~~~~~~~~~~lg~G~~g~V~~~~   28 (307)
T 2eva_A            4 MIDYKEIEVEEVVGRGAFGVVCKAK   28 (307)
T ss_dssp             BCCGGGEEEEEEEECCSSSEEEEEE
T ss_pred             cCCHhHeeeeeEeecCCCceEEEEE
Confidence            4567899999999999999999985

>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A*

Probab=96.72  E-value=0.00028  Score=45.58  Aligned_cols=23  Identities=22%  Similarity=0.368  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||+|+||.||+|.+
T Consensus        11 ~~~y~~~~~lg~G~~g~V~~~~~   33 (311)
T 3ork_A           11 SDRYELGEILGFGGMSEVHLARD   33 (311)
T ss_dssp             TTTEEEEEEEEECSSEEEEEEEE
T ss_pred             cCcEEEEEEEccCCCEEEEEEEE
Confidence            46899999999999999999863

>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus}

Probab=96.70  E-value=0.00037  Score=44.92  Aligned_cols=28  Identities=18%  Similarity=0.351  Sum_probs=21.3

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+..++|.+.+.||+|+||.||+|.+
T Consensus        17 ~~~i~~~~y~~~~~lg~G~~g~Vy~~~~   44 (323)
T 3qup_A           17 DVLIPEQQFTLGRMLGKGEFGSVREAQL   44 (323)
T ss_dssp             TTBCC---CEEEEEEEEETTEEEEEEEC
T ss_pred             hcccChhHeEEeceecccCCeEEEEEEE
Confidence            3445668999999999999999999864

>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A*

Probab=96.70  E-value=0.00036  Score=45.15  Aligned_cols=25  Identities=24%  Similarity=0.422  Sum_probs=21.8

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        42 ~~~~~~~~~~~~lG~G~~g~Vy~~~   66 (333)
T 2i1m_A           42 EFPRNNLQFGKTLGAGAFGKVVEAT   66 (333)
T ss_dssp             BCCTTSEEEEEEEEECSSEEEEEEE
T ss_pred             cCCHHHceeeeEeccCCCcceEEEE
Confidence            4556789999999999999999985

>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A*

Probab=96.69  E-value=0.00024  Score=47.34  Aligned_cols=23  Identities=35%  Similarity=0.715  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        53 ~~~y~~~~~lG~G~~g~V~~~~~   75 (382)
T 2vx3_A           53 MDRYEIDSLIGKGSFGQVVKAYD   75 (382)
T ss_dssp             TTTEEEEEEEEEETTEEEEEEEE
T ss_pred             eeeEEEEEEEeecCCEEEEEEEE
Confidence            47899999999999999999863

>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ...

Probab=96.68  E-value=0.00055  Score=45.91  Aligned_cols=25  Identities=32%  Similarity=0.458  Sum_probs=21.7

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        41 ~~~~~~~~~~~~lG~G~fg~Vy~~~   65 (373)
T 2qol_A           41 ELDATNISIDKVVGAGEFGEVCSGR   65 (373)
T ss_dssp             BCCGGGCCCCEEEEECSSSEEEEC-
T ss_pred             hcCHhhceeeeEEeeCCCeEEEEEE
Confidence            4567799999999999999999985

>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens}

Probab=96.67  E-value=0.00025  Score=45.37  Aligned_cols=26  Identities=27%  Similarity=0.353  Sum_probs=17.0

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+++|.+++.||+|+||.||+|.+
T Consensus        21 ~~~~~~y~~~~~lg~G~~g~V~~~~~   46 (318)
T 2dyl_A           21 QAEINDLENLGEMGSGTCGQVWKMRF   46 (318)
T ss_dssp             ECCGGGEEEEEEC------CEEEEEE
T ss_pred             hhhhccccccceeeecCCeeEEEEEE
Confidence            45778999999999999999999863

>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A*

Probab=96.67  E-value=0.0003  Score=44.78  Aligned_cols=25  Identities=32%  Similarity=0.388  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+.|++++.||+|+||.||+|.+
T Consensus        16 ~~~~~y~i~~~lg~G~~g~V~~~~~   40 (302)
T 2j7t_A           16 DPNEVWEIVGELGDGAFGKVYKAKN   40 (302)
T ss_dssp             CGGGTEEEEEEEECSTTCCEEEEEE
T ss_pred             CCccceeecceeccCCCeEEEEEEE
Confidence            3447899999999999999999863

>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A*

Probab=96.66  E-value=0.00031  Score=45.81  Aligned_cols=25  Identities=24%  Similarity=0.367  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        33 ~i~~~~y~i~~~lG~G~~g~V~~~~   57 (309)
T 3p86_A           33 DIPWCDLNIKEKIGAGSFGTVHRAE   57 (309)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             cCChhHceeeeEeecCCCeEEEEEE
Confidence            4566899999999999999999985

>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ...

Probab=96.65  E-value=0.00061  Score=43.42  Aligned_cols=28  Identities=21%  Similarity=0.153  Sum_probs=23.8

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+.-++|.+.+.||+|+||.||+|.+
T Consensus        18 ~~ei~~~~y~~~~~lG~G~~g~Vy~~~~   45 (289)
T 3og7_A           18 DWEIPDGQITVGQRIGSGSFGTVYKGKW   45 (289)
T ss_dssp             CCBCCTTSCEEEEEEEECSSEEEEEEES
T ss_pred             CCccCccceeeeeEecCCCCeEEEEEEE
Confidence            3456678999999999999999999863

>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A*

Probab=96.65  E-value=0.0003  Score=45.97  Aligned_cols=26  Identities=27%  Similarity=0.616  Sum_probs=21.6

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ....+++|.+++.||+|+||.||+|.
T Consensus        29 ~~~~~~~y~~~~~lg~G~~g~V~~~~   54 (329)
T 3gbz_A           29 SATSIDRYRRITKLGEGTYGEVYKAI   54 (329)
T ss_dssp             ---CGGGEEEEEEEEECSSSEEEEEE
T ss_pred             cccchhhEEEEEEEEecCCeEEEEEE
Confidence            35567899999999999999999985

>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ...

Probab=96.64  E-value=0.00032  Score=46.71  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=20.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        24 ~~~y~~~~~lG~G~~g~V~~~~~   46 (371)
T 2xrw_A           24 LKRYQNLKPIGSGAQGIVCAAYD   46 (371)
T ss_dssp             ETTEEEEEEEEECSSEEEEEEEE
T ss_pred             hhheeEeeeeEecCCEEEEEEEE
Confidence            47899999999999999999863

>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ...

Probab=96.64  E-value=0.00035  Score=46.23  Aligned_cols=22  Identities=32%  Similarity=0.555  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        27 ~~y~~~~~lG~G~~g~V~~~~~   48 (364)
T 3qyz_A           27 PRYTNLSYIGEGAYGMVCSAYD   48 (364)
T ss_dssp             TTEEEEEEEEECSSEEEEEEEE
T ss_pred             ccEEEEEEeecCCCeEEEEEEE
Confidence            5899999999999999999863

>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A

Probab=96.63  E-value=0.00039  Score=43.90  Aligned_cols=21  Identities=24%  Similarity=0.426  Sum_probs=18.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||+|+||.||+|.
T Consensus         9 ~~y~~~~~lg~G~~g~V~~~~   29 (296)
T 4hgt_A            9 NRYRLGRKIGSGSFGDIYLGT   29 (296)
T ss_dssp             --CEEEEEEEECSSSEEEEEE
T ss_pred             CceEEeeeecCCCCeEEEEEE
Confidence            679999999999999999986

>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp}

Probab=96.63  E-value=0.00027  Score=45.49  Aligned_cols=23  Identities=17%  Similarity=0.280  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        10 ~~~y~i~~~lg~G~~g~V~~~~~   32 (294)
T 4eqm_A           10 NERYKIVDKLGGGGMSTVYLAED   32 (294)
T ss_dssp             ETTEEEEEEEEEETTEEEEEEEE
T ss_pred             hccEEEEEEEccCCCEEEEEEEE
Confidence            46899999999999999999863

>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A*

Probab=96.62  E-value=0.00035  Score=44.59  Aligned_cols=25  Identities=24%  Similarity=0.406  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        19 ~~~~~~y~~~~~lg~G~~g~V~~~~   43 (314)
T 2ivs_A           19 EFPRKNLVLGKTLGEGEFGKVVKAT   43 (314)
T ss_dssp             BCCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             ccchhheeeeeeecccCCeeEEEEE
Confidence            4566899999999999999999985

>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A*

Probab=96.62  E-value=0.00028  Score=45.17  Aligned_cols=23  Identities=30%  Similarity=0.536  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -.++|.+++.||+|+||.||+|.
T Consensus        12 ~~~~y~~~~~lg~G~~g~V~~~~   34 (339)
T 1z57_A           12 LSARYEIVDTLGEGAFGKVVECI   34 (339)
T ss_dssp             ETTTEEEEEEEEEETTEEEEEEE
T ss_pred             ccCceEEEEEEecCCCeEEEEEE
Confidence            34789999999999999999985

>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A*

Probab=96.62  E-value=0.00037  Score=47.04  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -++|.+++.||+|+||.||+|.+
T Consensus        55 ~~~y~~~~~LG~G~fg~Vy~~~~   77 (390)
T 2zmd_A           55 GRIYSILKQIGSGGSSKVFQVLN   77 (390)
T ss_dssp             TEEEEEEEEEECCSSEEEEEEEC
T ss_pred             CCceEEEEEEccCCCeEEEEEEc
Confidence            35699999999999999999864

>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A*

Probab=96.62  E-value=0.00035  Score=47.73  Aligned_cols=22  Identities=50%  Similarity=0.845  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|++++.||+|+||.||+|.+
T Consensus        97 ~ry~~~~~LG~G~fg~V~~a~~  118 (429)
T 3kvw_A           97 YRYEVLKVIGKGSFGQVVKAYD  118 (429)
T ss_dssp             TTEEEEEEEEESSSEEEEEEEE
T ss_pred             CcEEEEEEcccCccEEEEEEEE
Confidence            3589999999999999999863

>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ...

Probab=96.62  E-value=0.00034  Score=44.68  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        23 ~~~~~~y~~~~~lg~G~~g~Vy~~~   47 (316)
T 2xir_A           23 EFPRDRLKLGKPLGRGAFGQVIEAD   47 (316)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ecchhheeeeeEEcCCCceeEEEEE
Confidence            4566899999999999999999985

>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A*

Probab=96.61  E-value=0.00036  Score=44.12  Aligned_cols=25  Identities=28%  Similarity=0.567  Sum_probs=22.7

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus        17 ~~~~~~y~~~~~lg~G~~g~V~~~~   41 (278)
T 1byg_A           17 ALNMKELKLLQTIGKGEFGDVMLGD   41 (278)
T ss_dssp             BCCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             cCChhhceEEeEEecCCCceEEEEE
Confidence            4677899999999999999999985

>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A

Probab=96.61  E-value=0.00043  Score=44.83  Aligned_cols=22  Identities=14%  Similarity=0.015  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|.+.+.||+|+||.||+|.+
T Consensus        31 ~~y~i~~~lg~G~~g~Vy~a~~   52 (286)
T 3uqc_A           31 GRYRLLIFHGGVPPLQFWQALD   52 (286)
T ss_dssp             TTEEEEEEEEBSTTCEEEEEEE
T ss_pred             CcEEEEEEEcccCCeEEEEEEe
Confidence            5699999999999999999864

>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7

Probab=96.61  E-value=0.00034  Score=45.49  Aligned_cols=25  Identities=36%  Similarity=0.521  Sum_probs=21.8

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        41 ~~~~~~y~~~~~lG~G~~g~V~~~~   65 (344)
T 1rjb_A           41 EFPRENLEFGKVLGSGAFGKVMNAT   65 (344)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ccCHHHceeeeeecCCCCceeEEee
Confidence            3456789999999999999999986

>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A

Probab=96.61  E-value=0.00035  Score=45.68  Aligned_cols=26  Identities=15%  Similarity=0.178  Sum_probs=22.5

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..++|.+++.||+|+||.||+|.+
T Consensus        15 ~~~~~~y~~~~~lg~G~~g~V~~~~~   40 (373)
T 1q8y_A           15 PYKDARYILVRKLGWGHFSTVWLAKD   40 (373)
T ss_dssp             EETTTTEEEEEEEEECSSEEEEEEEE
T ss_pred             cccCCeEEEEEeeeecCCeEEEEEEe
Confidence            34567899999999999999999863

>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens}

Probab=96.60  E-value=0.00035  Score=46.67  Aligned_cols=25  Identities=28%  Similarity=0.336  Sum_probs=21.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        65 ~i~~~~y~i~~~LG~G~~g~Vy~a~   89 (382)
T 3tt0_A           65 ELPRDRLVLGKPLGEGAFGQVVLAE   89 (382)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ccchhheEeeeEEecCCCeEEEEEE
Confidence            3455789999999999999999985

>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A*

Probab=96.60  E-value=0.00036  Score=43.91  Aligned_cols=24  Identities=42%  Similarity=0.779  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||.|+||.||+|.+
T Consensus         4 ~~~~y~~~~~lg~G~~g~V~~~~~   27 (279)
T 2w5a_A            4 RAEDYEVLYTIGTGSYGRCQKIRR   27 (279)
T ss_dssp             CGGGEEEEEEEEECSSSEEEEEEE
T ss_pred             chhheeeehhccCCCCcEEEEEEE
Confidence            467999999999999999999863

>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A*

Probab=96.60  E-value=0.00065  Score=44.01  Aligned_cols=25  Identities=24%  Similarity=0.456  Sum_probs=20.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus        26 ~~~~~~y~~~~~lg~G~~g~Vy~~~   50 (327)
T 2yfx_A           26 EVPRKNITLIRGLGHGAFGEVYEGQ   50 (327)
T ss_dssp             BCCGGGCEEEEECC--CSSCEEEEE
T ss_pred             cCChhheEEEEEEcCCCCeeEEEEE
Confidence            4566899999999999999999986

>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens}

Probab=96.58  E-value=0.00016  Score=46.88  Aligned_cols=22  Identities=32%  Similarity=0.620  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        57 ~~y~~~~~LG~G~~g~Vy~~~~   78 (311)
T 3p1a_A           57 QSFQRLSRLGHGSYGEVFKVRS   78 (311)
T ss_dssp             HHEEEEEEEEEETTEEEEEEEE
T ss_pred             hheeeeheeccCCCeEEEEEEE
Confidence            4588899999999999999863

>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A

Probab=96.58  E-value=0.00041  Score=47.19  Aligned_cols=22  Identities=27%  Similarity=0.526  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus       135 ~~y~~~~~LG~G~~g~V~~a~~  156 (419)
T 3i6u_A          135 DEYIMSKTLGSGACGEVKLAFE  156 (419)
T ss_dssp             TTEEEEEEEEECSSSEEEEEEE
T ss_pred             ccEEEEeEEeeCCCeEEEEEEE
Confidence            6799999999999999999863

>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X*

Probab=96.58  E-value=0.00033  Score=45.50  Aligned_cols=26  Identities=12%  Similarity=0.250  Sum_probs=22.5

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....++|.+++.||+|+||.||+|.+
T Consensus        27 ~~~~~~y~~~~~lg~G~~g~V~~~~~   52 (348)
T 2pml_X           27 DKYINDYRIIRTLNQGKFNKIILCEK   52 (348)
T ss_dssp             CEEETTEEEEEEEECCSSCCEEEEEE
T ss_pred             ccccCceEEEEEEcCCCCeEEEEEEc
Confidence            34568999999999999999999863

>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A*

Probab=96.58  E-value=0.00028  Score=44.26  Aligned_cols=25  Identities=32%  Similarity=0.440  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus         4 ~l~~~~y~~~~~lg~G~~g~V~~~~   28 (268)
T 3sxs_A            4 ELKREEITLLKELGSGQFGVVKLGK   28 (268)
T ss_dssp             BCCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             EechhheeeeeeeccCCCceEEEEE
Confidence            4567899999999999999999985

>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ...

Probab=96.57  E-value=0.00057  Score=44.45  Aligned_cols=25  Identities=20%  Similarity=0.331  Sum_probs=21.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..-.++|.+.+.||+|+||.||+|.
T Consensus        39 ~~~~~~y~~~~~lg~G~~g~Vy~~~   63 (320)
T 3a99_A           39 EPLESQYQVGPLLGSGGFGSVYSGI   63 (320)
T ss_dssp             -CCTTTEEEEEECSSSSSCEEEEEE
T ss_pred             CCccCceEEEEEEeeCCCeEEEEEE
Confidence            3455789999999999999999985

>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A*

Probab=96.56  E-value=0.0004  Score=43.94  Aligned_cols=25  Identities=28%  Similarity=0.517  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus         8 ~~~~~~y~~~~~lg~G~~g~Vy~~~   32 (281)
T 3cc6_A            8 GIAREDVVLNRILGEGFFGEVYEGV   32 (281)
T ss_dssp             SCCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             eecccceEEEEEEEecCCeeEEEeE
Confidence            4566899999999999999999985

>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A*

Probab=96.55  E-value=0.00047  Score=44.93  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        18 ~~~~~~y~~~~~lG~G~~g~Vy~~~   42 (359)
T 3vhe_A           18 EFPRDRLKLGKPLGRGAFGQVIEAD   42 (359)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             cccccceeeceeecCCCCceEEEEE
Confidence            3567899999999999999999985

>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=96.54  E-value=0.0003  Score=43.90  Aligned_cols=24  Identities=21%  Similarity=0.364  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+++.||+|+||.||+|.
T Consensus         5 i~~~~y~~~~~lg~G~~g~V~~~~   28 (267)
T 3t9t_A            5 IDPSELTFVQEIGSGQFGLVHLGY   28 (267)
T ss_dssp             CCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             EchhheeeeeEecCCCceeEEEEE
Confidence            466899999999999999999986

>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7

Probab=96.54  E-value=0.00046  Score=45.27  Aligned_cols=23  Identities=26%  Similarity=0.534  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||+|+||.||+|.+
T Consensus         4 ~~~y~~~~~lG~G~~g~Vy~~~~   26 (321)
T 1tki_A            4 YEKYMIAEDLGRGEFGIVHRCVE   26 (321)
T ss_dssp             TTTEEEEEEEEECSSEEEEEEEE
T ss_pred             hhceEeeeEEecCCCeEEEEEEE
Confidence            47899999999999999999853

>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ...

Probab=96.53  E-value=0.00047  Score=46.24  Aligned_cols=22  Identities=32%  Similarity=0.662  Sum_probs=16.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        29 ~~y~~~~~lG~G~~g~V~~a~~   50 (367)
T 2fst_X           29 ERYQNLSPVGSGAYGSVCAAFD   50 (367)
T ss_dssp             TTEEEEEECC----CCEEEEEE
T ss_pred             CceEEeeEEeecCCeEEEEEEE
Confidence            6899999999999999999863

>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A*

Probab=96.53  E-value=0.00034  Score=45.11  Aligned_cols=23  Identities=30%  Similarity=0.614  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        18 ~~~y~~~~~lg~G~~g~V~~~~~   40 (355)
T 2eu9_A           18 QERYEIVGNLGEGTFGKVVECLD   40 (355)
T ss_dssp             TTTEEEEEEEEEETTEEEEEEEE
T ss_pred             cccEEEEEEeeccCCeEEEEEEe
Confidence            47899999999999999999863

>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A*

Probab=96.52  E-value=0.00035  Score=47.61  Aligned_cols=23  Identities=26%  Similarity=0.488  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        25 ~~~y~~~~~lG~G~~g~V~~a~~   47 (432)
T 3n9x_A           25 PDNYIIKHLIGRGSYGYVYLAYD   47 (432)
T ss_dssp             CTTEEEEEEEEEETTEEEEEEEE
T ss_pred             cCCEEEEEEEeecCCEEEEEEEE
Confidence            37899999999999999999963

>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A*

Probab=96.51  E-value=0.00043  Score=44.12  Aligned_cols=25  Identities=24%  Similarity=0.369  Sum_probs=21.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        19 ~~~~~~y~~~~~lg~G~~g~V~~~~   43 (313)
T 1t46_A           19 EFPRNRLSFGKTLGAGAFGKVVEAT   43 (313)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ccChhhhhHHHhhCccCCcceEEEE
Confidence            4566789999999999999999985

>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A*

Probab=96.51  E-value=0.00048  Score=44.29  Aligned_cols=26  Identities=19%  Similarity=0.252  Sum_probs=21.9

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.-++|.+++.||+|+||.||+|.+
T Consensus        24 ~~~~~~y~~~~~lg~G~~g~Vy~~~~   49 (313)
T 3cek_A           24 SVKGRIYSILKQIGSGGSSKVFQVLN   49 (313)
T ss_dssp             EETTEEEEEEEEEECCSSEEEEEEEC
T ss_pred             eeccceEEEEEEecCCCCEEEEEEEc
Confidence            34456799999999999999999864

>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens}

Probab=96.50  E-value=0.00049  Score=43.79  Aligned_cols=22  Identities=27%  Similarity=0.401  Sum_probs=14.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        11 ~~y~~~~~lg~G~~g~V~~~~~   32 (320)
T 2i6l_A           11 SRYMDLKPLGCGGNGLVFSAVD   32 (320)
T ss_dssp             TTEEEEEECC-----CEEEEEE
T ss_pred             CceeEEEEeccCCCeEEEEEEE
Confidence            6799999999999999999863

>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens}

Probab=96.50  E-value=0.00048  Score=45.46  Aligned_cols=23  Identities=22%  Similarity=0.349  Sum_probs=20.1

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-++|.+.+.||+|+||.||+|.
T Consensus        63 ~~~~y~~~~~lG~G~~g~Vy~~~   85 (365)
T 3e7e_A           63 GSKLVYVHHLLGEGAFAQVYEAT   85 (365)
T ss_dssp             SSSEEEEEEEEEECSSEEEEEEE
T ss_pred             CCEEEEEEEEeeccCCEEEEEEE
Confidence            44678999999999999999993

>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A*

Probab=96.49  E-value=0.00044  Score=43.46  Aligned_cols=26  Identities=19%  Similarity=0.365  Sum_probs=22.8

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+..++|.+.+.||.|+||.||+|.
T Consensus         6 g~~~~~~y~i~~~lg~G~~g~V~~~~   31 (276)
T 2h6d_A            6 GRVKIGHYVLGDTLGVGTFGKVKIGE   31 (276)
T ss_dssp             -CCEETTEEEEEEEEECSSEEEEEEE
T ss_pred             CcceeccEEEEeeecCCCCeEEEEEE
Confidence            45677899999999999999999985

>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens}

Probab=96.48  E-value=0.00041  Score=43.72  Aligned_cols=23  Identities=26%  Similarity=0.550  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++|.+.+.||+|+||.||+|.
T Consensus         9 ~~~~y~~~~~lg~G~~g~Vy~~~   31 (278)
T 3cok_A            9 KIEDFKVGNLLGKGSFAGVYRAE   31 (278)
T ss_dssp             SGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ccccceeeeeecCCCceEEEEEE
Confidence            46789999999999999999986

>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A

Probab=96.48  E-value=0.00027  Score=46.97  Aligned_cols=22  Identities=27%  Similarity=0.622  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||.||+|.+
T Consensus        22 ~~y~~~~~lG~G~~g~V~~~~~   43 (342)
T 2qr7_A           22 DGYEVKEDIGVGSYSVCKRCIH   43 (342)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEE
T ss_pred             ccEEEEEEEeeCCCEEEEEEEE
Confidence            6799999999999999999863

>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens}

Probab=96.47  E-value=0.00054  Score=43.96  Aligned_cols=24  Identities=17%  Similarity=0.286  Sum_probs=18.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.++|.+.+.||+|+||.||+|.+
T Consensus        29 ~~~~y~~~~~lg~G~~g~Vy~~~~   52 (312)
T 2iwi_A           29 FEAEYRLGPLLGKGGFGTVFAGHR   52 (312)
T ss_dssp             ----CEEEEEEEEETTEEEEEEEC
T ss_pred             hhhceEEeeEEEcCCCEEEEEEEE
Confidence            346899999999999999999864

>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A*

Probab=96.47  E-value=0.00052  Score=44.65  Aligned_cols=22  Identities=27%  Similarity=0.526  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+.+.||+|+||.||+|.
T Consensus        10 ~~~y~~~~~lg~G~~g~V~~~~   31 (353)
T 2b9h_A           10 SSDFQLKSLLGEGAYGVVCSAT   31 (353)
T ss_dssp             CTTEEEEEEEEECSSEEEEEEE
T ss_pred             ccceEEeeEEcCCCCeEEEEEE
Confidence            3789999999999999999986

>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7

Probab=96.47  E-value=0.0005  Score=45.94  Aligned_cols=23  Identities=26%  Similarity=0.554  Sum_probs=14.4

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        24 ~~~y~~~~~lG~G~~g~V~~a~~   46 (367)
T 1cm8_A           24 RAVYRDLQPVGSGAYGAVCSAVD   46 (367)
T ss_dssp             BSSEEEEEEC------CEEEEEE
T ss_pred             cceEEEeEEeeecCCeEEEEEEE
Confidence            36799999999999999999863

>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A*

Probab=96.46  E-value=0.00061  Score=44.64  Aligned_cols=24  Identities=17%  Similarity=0.358  Sum_probs=21.1

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.++|.+.+.||+|+||.||+|.+
T Consensus        20 ~~~~y~~~~~lg~G~~g~V~~~~~   43 (362)
T 3pg1_A           20 MQSPYTVQRFISSGSYGAVCAGVD   43 (362)
T ss_dssp             TTCSCEEEEEEEEETTEEEEEEEC
T ss_pred             hccceEEeEEeccCCCEEEEEEEC
Confidence            346899999999999999999864

>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens}

Probab=96.46  E-value=0.00036  Score=46.02  Aligned_cols=21  Identities=24%  Similarity=0.547  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||+|.
T Consensus        24 ~~y~~~~~lG~G~~g~Vy~a~   44 (335)
T 3dls_A           24 QKYSTMSPLGSGAFGFVWTAV   44 (335)
T ss_dssp             HHEEEEEECSSSSSCSEEEEE
T ss_pred             cceEEEeEEEecCCEEEEEEE
Confidence            579999999999999999995

>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7

Probab=96.46  E-value=0.0006  Score=44.77  Aligned_cols=24  Identities=29%  Similarity=0.533  Sum_probs=17.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus         8 ~~~~y~~~~~lg~G~~g~Vy~~~~   31 (346)
T 1ua2_A            8 RAKRYEKLDFLGEGQFATVYKARD   31 (346)
T ss_dssp             -----CEEEEEEEETTEEEEEEEC
T ss_pred             HhcccEEEeEEeecCCEEEEEEEE
Confidence            457899999999999999999864

>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ...

Probab=96.45  E-value=0.00047  Score=43.57  Aligned_cols=26  Identities=19%  Similarity=0.326  Sum_probs=22.5

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..++|.+.+.||+|+||.||+|.+
T Consensus         9 ~~~~~~~~~~~~lg~G~~g~V~~~~~   34 (288)
T 3kfa_A            9 EMERTDITMKHKLGGGQYGEVYEGVW   34 (288)
T ss_dssp             BCCGGGEEEEEESGGGTTCSEEEEEE
T ss_pred             cccccceeEEeecCCCCceeEEEeEe
Confidence            45678899999999999999999863

>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens}

Probab=96.45  E-value=0.0005  Score=45.17  Aligned_cols=25  Identities=24%  Similarity=0.254  Sum_probs=15.5

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|.+.+.||+|+||.||+|.+
T Consensus        34 ~~~~~y~~~~~lg~G~~g~Vy~~~~   58 (345)
T 2v62_A           34 MEGNQWVLGKKIGSGGFGLIYLAFP   58 (345)
T ss_dssp             TTSCEEEEEEEC------CEEEEEE
T ss_pred             ccCceEEEEeeEeecCCeEEEEEEe
Confidence            3456899999999999999999863

>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus}

Probab=96.44  E-value=0.00057  Score=47.94  Aligned_cols=27  Identities=19%  Similarity=0.351  Sum_probs=23.9

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+.+++|.+.+.||+|+||.||+|.
T Consensus        10 ~~~~~~~~Y~l~~~LG~G~fg~V~~a~   36 (476)
T 2y94_A           10 DGRVKIGHYILGDTLGVGTFGKVKVGK   36 (476)
T ss_dssp             CSCCEETTEEEEEEEECCSSSCEEEEE
T ss_pred             CCCceecCEEEEEEEeeCCCeEEEEEE
Confidence            445678999999999999999999986

>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B

Probab=96.44  E-value=0.00038  Score=44.70  Aligned_cols=21  Identities=33%  Similarity=0.591  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||+|.
T Consensus        11 ~~y~~~~~lg~G~~g~V~~~~   31 (326)
T 1blx_A           11 QQYECVAEIGEGAYGKVFKAR   31 (326)
T ss_dssp             GTEEEEEEEEEETTEEEEEEE
T ss_pred             hceeeeeeecccccEEEEEEE
Confidence            689999999999999999986

>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ...

Probab=96.43  E-value=0.00026  Score=44.37  Aligned_cols=22  Identities=36%  Similarity=0.810  Sum_probs=19.8

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+++.||+|+||.||+|.
T Consensus         6 ~~~y~~~~~lg~G~~g~V~~~~   27 (276)
T 2yex_A            6 VEDWDLVQTLGEGAYGEVQLAV   27 (276)
T ss_dssp             HHHEEEEEEEEECSSSEEEEEE
T ss_pred             ecceEEEEEeecCCCcEEEEEE
Confidence            3679999999999999999985

>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii}

Probab=96.42  E-value=0.00032  Score=44.78  Aligned_cols=22  Identities=27%  Similarity=0.421  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus        22 ~~y~~~~~lg~G~~g~V~~~~~   43 (285)
T 3is5_A           22 DLFIFKRKLGSGAFGDVHLVEE   43 (285)
T ss_dssp             HHEEEEEEEEECSSCEEEEEEE
T ss_pred             hheeecceeccCCCeEEEEEEE
Confidence            6799999999999999999863

>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus}

Probab=96.42  E-value=0.00051  Score=45.69  Aligned_cols=19  Identities=37%  Similarity=0.434  Sum_probs=15.8

Q ss_pred             CccccccCCccceEeeecC
Q psy17601         46 EPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        46 ~~~~~iG~G~fG~V~La~~   64 (64)
                      .+-+.||+|+||+||+|.+
T Consensus        29 ~~~~~iG~G~fg~Vy~a~~   47 (290)
T 3fpq_A           29 KFDIEIGRGSFKTVYKGLD   47 (290)
T ss_dssp             EEEEEEEECSSEEEEEEEE
T ss_pred             EeeeEEecCcCcEEEEEEE
Confidence            4556799999999999863

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}

Probab=96.41  E-value=0.00056  Score=47.38  Aligned_cols=23  Identities=26%  Similarity=0.452  Sum_probs=18.4

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        35 ~~~Y~~~~~lG~G~~g~V~~~~~   57 (504)
T 3q5i_A           35 GESYFKVRKLGSGAYGEVLLCKE   57 (504)
T ss_dssp             GGTEEEEEEEEC--CEEEEEEEE
T ss_pred             ccceEEEeEecccCCeEEEEEEE
Confidence            36899999999999999999863

>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A*

Probab=96.41  E-value=0.00042  Score=46.64  Aligned_cols=22  Identities=18%  Similarity=0.286  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus        12 ~~y~~~~~LG~G~fg~V~~~~~   33 (361)
T 2yab_A           12 DFYDIGEELGSGQFAIVKKCRE   33 (361)
T ss_dssp             GTEEEEEEEEEETTEEEEEEEE
T ss_pred             hceEEeeEEeeCcCEEEEEEEE
Confidence            5799999999999999999863

>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A*

Probab=96.41  E-value=0.00032  Score=45.43  Aligned_cols=22  Identities=27%  Similarity=0.526  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        10 ~~y~~~~~lg~G~~g~V~~~~~   31 (322)
T 2ycf_A           10 DEYIMSKTLGSGACGEVKLAFE   31 (322)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEE
T ss_pred             hceeEeeEEecCCCEEEEEEEE
Confidence            5789999999999999999863

>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens}

Probab=96.40  E-value=0.00039  Score=44.92  Aligned_cols=25  Identities=12%  Similarity=0.112  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..-+.|.+.+.||+|+||.||+|.+
T Consensus         6 ~~~~~y~~~~~lg~G~~g~V~~~~~   30 (319)
T 4euu_A            6 TSNHLWLLSDILGQGATANVFRGRH   30 (319)
T ss_dssp             CSSEEEEEEEEEEECSSEEEEEEEE
T ss_pred             CCCCCEEEEEEecCCCCeEEEEEEE
Confidence            3446799999999999999999863

>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A

Probab=96.40  E-value=0.00032  Score=44.25  Aligned_cols=21  Identities=48%  Similarity=0.866  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||+|.
T Consensus         6 ~~y~~~~~lg~G~~g~V~~~~   26 (303)
T 1zy4_A            6 SDFEEIAVLGQGAFGQVVKAR   26 (303)
T ss_dssp             HHEEEEEEEEECSSEEEEEEE
T ss_pred             ccchhhheeccCCcEEEEEEE
Confidence            579999999999999999986

>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A*

Probab=96.39  E-value=0.00043  Score=46.26  Aligned_cols=24  Identities=42%  Similarity=0.493  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+.+.||+|+||.||+|.
T Consensus       111 ~~~~~~~~~~~lG~G~~g~V~~~~  134 (377)
T 3cbl_A          111 LNHEDLVLGEQIGRGNFGEVFSGR  134 (377)
T ss_dssp             CCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             EchHHeEEeeEeccCCCCeEEEEE
Confidence            355789999999999999999986

>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A*

Probab=96.39  E-value=0.00065  Score=43.10  Aligned_cols=25  Identities=28%  Similarity=0.448  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      --.++|.+.+.||+|+||.||+|.+
T Consensus        14 ~~~~~y~~~~~lg~G~~g~V~~~~~   38 (298)
T 1phk_A           14 GFYENYEPKEILGRGVSSVVRRCIH   38 (298)
T ss_dssp             -CTTTEEEEEEEEECSSEEEEEEEE
T ss_pred             chhhccceeeeecCCCceEEEEEEE
Confidence            3468999999999999999999863

>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ...

Probab=96.38  E-value=0.0006  Score=43.80  Aligned_cols=24  Identities=21%  Similarity=0.444  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus        22 ~~~~~y~~~~~lg~G~~g~Vy~~~   45 (322)
T 1p4o_A           22 VAREKITMSRELGQGSFGMVYEGV   45 (322)
T ss_dssp             CCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             chhhheeeeeEeccCCceEEEeee
Confidence            445688999999999999999975

>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A

Probab=96.38  E-value=0.0014  Score=41.97  Aligned_cols=22  Identities=23%  Similarity=0.448  Sum_probs=18.6

Q ss_pred             CCCCcc-ccccCCccceEeeecC
Q psy17601         43 EDFEPL-KVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~-~~iG~G~fG~V~La~~   64 (64)
                      +.|.+. +.||+|+||.||+|.+
T Consensus        12 ~~y~i~~~~lg~G~~g~V~~~~~   34 (316)
T 2ac3_A           12 DVYQLQEDVLGEGAHARVQTCIN   34 (316)
T ss_dssp             TSCEECCCCCCCCSSEEEEEEEC
T ss_pred             eeEEecCceecCCceEEEEEEEE
Confidence            567775 7899999999999864

>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A*

Probab=96.38  E-value=0.00059  Score=43.72  Aligned_cols=24  Identities=33%  Similarity=0.480  Sum_probs=19.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++|.+.+.||+|+||.||+|.
T Consensus        29 ~~~~~y~~~~~lg~G~~g~Vy~~~   52 (310)
T 2wqm_A           29 NTLANFRIEKKIGRGQFSEVYRAA   52 (310)
T ss_dssp             SSGGGEEEEEEEECC--CEEEEEE
T ss_pred             ccccceEEEEeecCCCCceEEEEE
Confidence            456789999999999999999985

>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis}

Probab=96.38  E-value=0.00066  Score=43.84  Aligned_cols=25  Identities=16%  Similarity=0.377  Sum_probs=20.2

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+++|.+++.||+|+||.||+|.
T Consensus        30 ~~~~~~y~~~~~lg~G~~g~Vy~~~   54 (309)
T 2h34_A           30 GTQFGPYRLRRLVGRGGMGDVYEAE   54 (309)
T ss_dssp             ----CCEEEEEEEEECSSSEEEEEE
T ss_pred             CcEeccEEEEEEEcCCCCeeEEEEE
Confidence            4567899999999999999999986

>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A*

Probab=96.37  E-value=0.00049  Score=43.40  Aligned_cols=22  Identities=18%  Similarity=0.543  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+.+.||+|+||.||+|.
T Consensus         5 ~~~y~~~~~lg~G~~g~V~~~~   26 (284)
T 3kk8_A            5 SDNYDVKEELGKGAFSVVRRCV   26 (284)
T ss_dssp             TTTEEEEEEEEEETTEEEEEEE
T ss_pred             hhhhhhhhhhcCcCCeEEEEEE
Confidence            4789999999999999999985

>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A

Probab=96.37  E-value=0.00049  Score=43.54  Aligned_cols=21  Identities=24%  Similarity=0.426  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||+|+||.||+|.
T Consensus         9 ~~y~~~~~lg~G~~g~V~~~~   29 (296)
T 3uzp_A            9 NRYRLGRKIGSGSFGDIYLGT   29 (296)
T ss_dssp             TTEEEEEEEEEETTEEEEEEE
T ss_pred             cEEEEEEEEccCCCeEEEEEE
Confidence            689999999999999999986

>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=96.37  E-value=0.00083  Score=43.97  Aligned_cols=25  Identities=36%  Similarity=0.486  Sum_probs=22.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        40 ~i~~~~~~~~~~lG~G~~g~Vy~~~   64 (333)
T 1mqb_A           40 EIHPSCVTRQKVIGAGEFGEVYKGM   64 (333)
T ss_dssp             BCCTTTEEEEEEEEECSSSEEEEEE
T ss_pred             cCChHHhhcccEEecCCCeEEEEEE
Confidence            5677899999999999999999985

>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ...

Probab=96.36  E-value=0.00046  Score=43.50  Aligned_cols=24  Identities=25%  Similarity=0.389  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||.||+|.
T Consensus        10 v~~~~y~~~~~lg~G~~g~Vy~~~   33 (279)
T 1qpc_A           10 VPRETLKLVERLGAGQFGEVWMGY   33 (279)
T ss_dssp             CCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             cCHHhhhheeeecCCCCeEEEEEE
Confidence            455789999999999999999985

>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A

Probab=96.36  E-value=0.00065  Score=45.17  Aligned_cols=22  Identities=27%  Similarity=0.551  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus        42 ~~y~~~~~lG~G~~g~Vy~~~~   63 (371)
T 4exu_A           42 KTYVSPTHVGSGAYGSVCSAID   63 (371)
T ss_dssp             TTEEEEEEEEECSSEEEEEEEE
T ss_pred             ccEEEEeEEecCCCeEEEEEEE
Confidence            6899999999999999999863

>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A*

Probab=96.35  E-value=0.00027  Score=44.21  Aligned_cols=22  Identities=36%  Similarity=0.667  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        11 ~~y~~~~~lg~G~~g~V~~~~~   32 (289)
T 1x8b_A           11 TEFHELEKIGSGEFGSVFKCVK   32 (289)
T ss_dssp             HHEEEEEEEEEETTEEEEEEEE
T ss_pred             chhhhhhhhcCCCceEEEEEEE
Confidence            5799999999999999999863

>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ...

Probab=96.35  E-value=0.0005  Score=46.80  Aligned_cols=22  Identities=32%  Similarity=0.462  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|.+++.||+|+||.||+|.+
T Consensus        54 ~~y~~~~~lG~G~fg~Vy~~~~   75 (420)
T 1j1b_A           54 VSYTDTKVIGNGSFGVVYQAKL   75 (420)
T ss_dssp             EEEEEEEEEEECSSEEEEEEEE
T ss_pred             ceEEeeeEEeeCCCEEEEEEEE
Confidence            4699999999999999999863

>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens}

Probab=96.35  E-value=0.00044  Score=44.38  Aligned_cols=24  Identities=13%  Similarity=0.249  Sum_probs=19.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||.||+|.
T Consensus        26 i~~~~y~~~~~lg~G~~g~V~~~~   49 (317)
T 2buj_A           26 IDNKHYLFIQKLGEGGFSYVDLVE   49 (317)
T ss_dssp             ETTEEEEEEEEEEC--CEEEEEEE
T ss_pred             ECCeEEEEEEEecCCCCeEEEEEE
Confidence            455789999999999999999986

>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A*

Probab=96.35  E-value=0.00071  Score=42.83  Aligned_cols=24  Identities=21%  Similarity=0.273  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.-++|.+.+.||+|+||.||+|.
T Consensus         7 ~~~~~y~~~~~lg~G~~g~V~~~~   30 (298)
T 1csn_A            7 VVGVHYKVGRRIGEGSFGVIFEGT   30 (298)
T ss_dssp             EETTTEEEEEEEEECSSCEEEEEE
T ss_pred             ccccceEEEEEEeecCCEEEEEEE
Confidence            345789999999999999999986

>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7

Probab=96.33  E-value=0.00034  Score=45.05  Aligned_cols=23  Identities=26%  Similarity=0.385  Sum_probs=20.5

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -.++|.+++.||+|+||.||+|.
T Consensus        35 ~~~~y~~~~~lg~G~~g~V~~~~   57 (337)
T 3mdy_A           35 IAKQIQMVKQIGKGRYGEVWMGK   57 (337)
T ss_dssp             HHHHCEEEEEEEEETTEEEEEEE
T ss_pred             cccceEEEeEeecCCCeEEEEEE
Confidence            34689999999999999999985

>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis}

Probab=96.32  E-value=0.00041  Score=46.75  Aligned_cols=21  Identities=33%  Similarity=0.504  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||+|+||.||+|.
T Consensus        40 ~~Y~~~~~lG~G~~g~V~~a~   60 (394)
T 4e7w_A           40 IAYTNCKVIGNGSFGVVFQAK   60 (394)
T ss_dssp             EEEEEEEEEEEETTEEEEEEE
T ss_pred             ceEEEeEEEeeCCCeEEEEEE
Confidence            469999999999999999986

>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B*

Probab=96.32  E-value=0.00058  Score=43.11  Aligned_cols=25  Identities=28%  Similarity=0.551  Sum_probs=18.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||+|.
T Consensus        14 ~~~~~~y~~~~~lg~G~~g~Vy~~~   38 (291)
T 1u46_A           14 LIGEKDLRLLEKLGDGSFGVVRRGE   38 (291)
T ss_dssp             ECCGGGEEEEEECC----CCCEEEE
T ss_pred             ccchhHeeeeeeecCCCceeEEEEE
Confidence            4566899999999999999999985

>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A

Probab=96.31  E-value=0.00066  Score=46.56  Aligned_cols=25  Identities=28%  Similarity=0.567  Sum_probs=22.4

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++.++|.+++.||+|+||.||++.
T Consensus       189 ~i~~~~~~~~~~lG~G~fg~V~~~~  213 (450)
T 1k9a_A          189 ALNMKELKLLQTIGKGEFGDVMLGD  213 (450)
T ss_dssp             BCCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             ccChHHeEEEeeecCcCCeeEEEEE
Confidence            4677899999999999999999975

>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B

Probab=96.30  E-value=0.00079  Score=46.15  Aligned_cols=24  Identities=29%  Similarity=0.389  Sum_probs=20.6

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus       185 i~~~~~~~~~~lG~G~fg~V~~~~  208 (454)
T 1qcf_A          185 IPRESLKLEKKLGAGQFGEVWMAT  208 (454)
T ss_dssp             CCGGGEEEEEEEECCSSEEEEEEE
T ss_pred             echHHeEEEEEcccCCceEEEEEE
Confidence            345678889999999999999985

>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens}

Probab=96.30  E-value=0.00067  Score=44.93  Aligned_cols=22  Identities=27%  Similarity=0.253  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|.+.+.||+|+||.||+|.+
T Consensus        53 ~~y~~~~~lG~G~~g~Vy~~~~   74 (349)
T 2w4o_A           53 DFFEVESELGRGATSIVYRCKQ   74 (349)
T ss_dssp             GTEEEEEEEEECSSEEEEEEEE
T ss_pred             CcEEEeeEEeeCCCEEEEEEEE
Confidence            5699999999999999999863

>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group}

Probab=96.29  E-value=0.00086  Score=47.08  Aligned_cols=22  Identities=32%  Similarity=0.412  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+++.||+|+||.||+|.
T Consensus         6 ~~~y~i~~~LG~G~fG~Vy~a~   27 (483)
T 3sv0_A            6 GNKFRLGRKIGSGSFGEIYLGT   27 (483)
T ss_dssp             TTTEECCCCCEECSSCEEEEEE
T ss_pred             CCcEEEEEEEeeCCCEEEEEEE
Confidence            3689999999999999999986

>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens}

Probab=96.28  E-value=0.00083  Score=42.99  Aligned_cols=24  Identities=33%  Similarity=0.558  Sum_probs=15.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...++|++++.||.|+||.||+|.
T Consensus        26 ~~~~~y~~~~~lg~G~~g~Vy~~~   49 (314)
T 3com_A           26 QPEEVFDVLEKLGEGSYGSVYKAI   49 (314)
T ss_dssp             ----CEEEEEECC----CEEEEEE
T ss_pred             cchhhhhhheeeccCCCeEEEEEE
Confidence            345789999999999999999985

>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens}

Probab=96.27  E-value=0.0007  Score=43.35  Aligned_cols=24  Identities=21%  Similarity=0.293  Sum_probs=20.5

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .-.+|.+.+.||+|+||.||+|.+
T Consensus        26 ~~~~y~~~~~lg~G~~g~V~~~~~   49 (337)
T 3ll6_A           26 GELRLRVRRVLAEGGFAFVYEAQD   49 (337)
T ss_dssp             TTEEEEEEEEEECCSSEEEEEEEE
T ss_pred             cCceEEEEEEEccCCceEEEEEEE
Confidence            334789999999999999999863

>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II}

Probab=96.26  E-value=0.00045  Score=44.80  Aligned_cols=22  Identities=23%  Similarity=0.533  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        26 ~~y~~~~~lG~G~~g~V~~~~~   47 (345)
T 3hko_A           26 KKYHLKGAIGQGSYGVVRVAIE   47 (345)
T ss_dssp             HHEEEEEEEEECSSCEEEEEEE
T ss_pred             hheeecceeeecCCeEEEEEEE
Confidence            4699999999999999999853

>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C

Probab=96.26  E-value=0.00057  Score=46.30  Aligned_cols=24  Identities=21%  Similarity=0.447  Sum_probs=20.0

Q ss_pred             CCCCCCcc-ccccCCccceEeeecC
Q psy17601         41 GVEDFEPL-KVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~-~~iG~G~fG~V~La~~   64 (64)
                      .+++|.++ ++||+|+||.||+|.+
T Consensus        59 ~~~~y~~~~~~LG~G~~g~V~~~~~   83 (400)
T 1nxk_A           59 IIDDYKVTSQVLGLGINGKVLQIFN   83 (400)
T ss_dssp             GGGTEEEEEEEEEEETTEEEEEEEE
T ss_pred             ccccceeccceeeeccCeEEEEEEE
Confidence            35788887 6999999999999863

>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B*

Probab=96.25  E-value=0.00061  Score=42.73  Aligned_cols=22  Identities=36%  Similarity=0.702  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|.+++.||+|+||.||+|.+
T Consensus        11 ~~y~~~~~lg~G~~g~V~~~~~   32 (284)
T 2a19_B           11 MDFKEIELIGSGGFGQVFKAKH   32 (284)
T ss_dssp             HHEEEEEEEECSSSCCEEEEEE
T ss_pred             cccceeeeeccCCceEEEEEEE
Confidence            4789999999999999999863

>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A*

Probab=96.24  E-value=0.00082  Score=43.11  Aligned_cols=27  Identities=19%  Similarity=0.230  Sum_probs=21.8

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+..++|.+.+.||+|+||.||+|.
T Consensus        28 ~~~~~~~~y~~~~~lg~G~~g~V~~~~   54 (313)
T 3brb_A           28 DVVIDRNLLILGKILGEGEFGSVMEGN   54 (313)
T ss_dssp             TTBCCGGGEEEEEEEEC-CCCCEEEEE
T ss_pred             hcccCHHHeeeccceeecCCeEEEEEE
Confidence            335566889999999999999999875

>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7

Probab=96.23  E-value=0.0006  Score=46.32  Aligned_cols=23  Identities=26%  Similarity=0.606  Sum_probs=20.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        50 ~~~y~i~~~LG~G~~g~Vy~~~~   72 (387)
T 1kob_A           50 YDYYDILEELGSGAFGVVHRCVE   72 (387)
T ss_dssp             GGTEEEEEEEEEETTEEEEEEEE
T ss_pred             ccceEEEEEEecCCCEEEEEEEE
Confidence            36899999999999999999863

>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A

Probab=96.23  E-value=0.00056  Score=45.52  Aligned_cols=23  Identities=13%  Similarity=0.017  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||+|+||.||+|.+
T Consensus        72 ~~~y~~~~~lG~G~~g~V~~a~~   94 (377)
T 3byv_A           72 PRTLVRGTVLGQEDPYAYLEATD   94 (377)
T ss_dssp             CEEEEEEEEEEEETTEEEEEEEC
T ss_pred             CceEEEcceeecCCCEEEEEEEE
Confidence            46899999999999999999874

>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A*

Probab=96.22  E-value=0.00071  Score=43.82  Aligned_cols=26  Identities=15%  Similarity=0.323  Sum_probs=22.9

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-++.++|.+++.||+|+||.||+|.
T Consensus        18 ~~~~~~~y~~~~~lg~G~~g~V~~~~   43 (327)
T 3lxl_A           18 TIFEERHLKYISQLGKGNFGSVELCR   43 (327)
T ss_dssp             CBCCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             hhhchhhhhhhhhccCCCCeEEEEEE
Confidence            34667899999999999999999986

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*

Probab=96.22  E-value=0.00059  Score=46.99  Aligned_cols=22  Identities=36%  Similarity=0.682  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        22 ~~y~~~~~lG~G~~g~V~~~~~   43 (486)
T 3mwu_A           22 ERYNIVCMLGKGSFGEVLKCKD   43 (486)
T ss_dssp             HHEEEEEEEECCSSSEEEEEEE
T ss_pred             cceEEeEEEeecCCEEEEEEEE
Confidence            6799999999999999999863

>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A*

Probab=96.22  E-value=0.00061  Score=43.73  Aligned_cols=24  Identities=21%  Similarity=0.447  Sum_probs=20.3

Q ss_pred             CCCCCCcc-ccccCCccceEeeecC
Q psy17601         41 GVEDFEPL-KVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~-~~iG~G~fG~V~La~~   64 (64)
                      -+++|.++ ++||+|+||.||+|.+
T Consensus        15 ~~~~y~~~~~~lg~G~~g~V~~~~~   39 (299)
T 3m2w_A           15 IIDDYKVTSQVLGLGINGKVLQIFN   39 (299)
T ss_dssp             GGGTEEEEEEEEEEETTEEEEEEEE
T ss_pred             cccchhhcCcccccCCCeEEEEEEE
Confidence            34788888 7899999999999863

>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A*

Probab=96.22  E-value=0.00096  Score=42.38  Aligned_cols=24  Identities=17%  Similarity=0.319  Sum_probs=20.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +....|.+++.||+|+||.||+|.
T Consensus        18 ~~~~~~~~~~~lg~G~~g~V~~~~   41 (302)
T 4e5w_A           18 FEKRFLKRIRDLGEGHFGKVELCR   41 (302)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             hhhhhhhhhhccCCCCceEEEEEE
Confidence            344568889999999999999986

>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens}

Probab=96.20  E-value=0.00089  Score=43.88  Aligned_cols=22  Identities=27%  Similarity=0.551  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus        24 ~~y~~~~~lg~G~~g~V~~~~~   45 (353)
T 3coi_A           24 KTYVSPTHVGSGAYGSVCSAID   45 (353)
T ss_dssp             TTEEEEEEEEECSSEEEEEEEE
T ss_pred             ceEEEeeeEecCCCeEEEEEEE
Confidence            6899999999999999999863

>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A*

Probab=96.19  E-value=0.00088  Score=42.76  Aligned_cols=21  Identities=52%  Similarity=0.792  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|.+++.||+|+||.||+|.
T Consensus        22 ~~y~~~~~lg~G~~g~V~~~~   42 (303)
T 3a7i_A           22 ELFTKLEKIGKGSFGEVFKGI   42 (303)
T ss_dssp             GTEEEEEEEEECSSSEEEEEE
T ss_pred             HHHHHhhhhcccCCeEEEEEE
Confidence            569999999999999999985

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*

Probab=96.18  E-value=0.00057  Score=47.24  Aligned_cols=22  Identities=36%  Similarity=0.582  Sum_probs=16.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|.+++.||+|+||.||+|.+
T Consensus        37 ~~y~~~~~lG~G~~g~V~~~~~   58 (494)
T 3lij_A           37 EMYQRVKKLGSGAYGEVLLCRD   58 (494)
T ss_dssp             HHEEEEEEEECC---EEEEEEE
T ss_pred             cCeEEeeEEecCCCEEEEEEEE
Confidence            3699999999999999999863

>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A*

Probab=96.18  E-value=0.00059  Score=43.40  Aligned_cols=25  Identities=20%  Similarity=0.462  Sum_probs=21.6

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...++|.+.+.||+|+||.||+|.+
T Consensus        12 ~~~~~y~~~~~lg~G~~g~Vy~~~~   36 (294)
T 2rku_A           12 RSRRRYVRGRFLGKGGFAKCFEISD   36 (294)
T ss_dssp             TTTEEEEEEEEEEEETTEEEEEEEE
T ss_pred             CcccceEEEEEEeecCCEEEEEEEE
Confidence            4557899999999999999999863

>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A

Probab=96.17  E-value=0.00051  Score=44.52  Aligned_cols=22  Identities=18%  Similarity=0.286  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus        12 ~~y~~~~~lg~G~~g~V~~~~~   33 (321)
T 2a2a_A           12 DFYDIGEELGSGQFAIVKKCRE   33 (321)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEE
T ss_pred             ccEEEeeEeeecCCEEEEEEEE
Confidence            5689999999999999999863

>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A

Probab=96.17  E-value=0.00052  Score=45.44  Aligned_cols=21  Identities=33%  Similarity=0.604  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|.+++.||+|+||.||+|.
T Consensus        24 ~~y~~~~~lG~G~~g~V~~~~   44 (351)
T 3c0i_A           24 DVYELCEVIGKGPFSVVRRCI   44 (351)
T ss_dssp             HHEEEEEEEEECSSEEEEEEE
T ss_pred             cceEEeeEEeeCCCEEEEEEE
Confidence            569999999999999999985

>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens}

Probab=96.16  E-value=0.0018  Score=40.91  Aligned_cols=26  Identities=19%  Similarity=0.310  Sum_probs=21.7

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....++|....+||+|+||.||+|.+
T Consensus        18 ~~~~~~~~~~~~lg~G~~g~Vy~~~~   43 (295)
T 2clq_A           18 DYEYDENGDRVVLGKGTYGIVYAGRD   43 (295)
T ss_dssp             EECBCTTSSBCEEEECSSSEEEEEEE
T ss_pred             cccccCCCCcEEEeecCcEEEEEEEE
Confidence            35667788888999999999999863

>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A*

Probab=96.14  E-value=0.00075  Score=44.71  Aligned_cols=23  Identities=9%  Similarity=-0.038  Sum_probs=19.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+|.+++.||+|+||.||+|.+
T Consensus        61 ~~~y~~~~~lG~G~~g~V~~~~~   83 (371)
T 3q60_A           61 ERKLKLVEPLRVGDRSVVFLVRD   83 (371)
T ss_dssp             EEEEEEEEEEEECSSEEEEEEEE
T ss_pred             ceeeeeeeeccCCCCEEEEEEEE
Confidence            34699999999999999999863

>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens}

Probab=96.14  E-value=0.0014  Score=42.54  Aligned_cols=27  Identities=19%  Similarity=0.380  Sum_probs=22.2

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+..++|.+++.||+|+||.||+|.
T Consensus        35 ~~~~~~~~y~~~~~lg~G~~g~V~~~~   61 (326)
T 2w1i_A           35 PTQFEERHLKFLQQLGKGNFGSVEMCR   61 (326)
T ss_dssp             --CCCGGGEEEEEEEECCSSEEEEEEE
T ss_pred             ccccCHHHceeeeeeccCCCeEEEEEE
Confidence            345666789999999999999999985

>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens}

Probab=96.13  E-value=0.00068  Score=45.54  Aligned_cols=24  Identities=13%  Similarity=0.134  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .-+.|.+.+.||+|+||.||+|.+
T Consensus         7 ~~~~y~i~~~LG~G~~g~Vy~~~~   30 (396)
T 4eut_A            7 SNHLWLLSDILGQGATANVFRGRH   30 (396)
T ss_dssp             SSEEEEEEEEEEECSSEEEEEEEE
T ss_pred             CCCceEEEEEEEcCCCeEEEEEEE
Confidence            346799999999999999999864

>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens}

Probab=96.12  E-value=0.0008  Score=43.28  Aligned_cols=26  Identities=27%  Similarity=0.454  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....++|.+++.||+|+||.||+|.+
T Consensus        20 ~~~~~~y~~~~~lg~G~~g~Vy~~~~   45 (326)
T 2x7f_A           20 RDPAGIFELVELVGNGTYGQVYKGRH   45 (326)
T ss_dssp             CCCTTTEEEEEEEEEETTEEEEEEEE
T ss_pred             cCCCCcEEEEEEeccCCCEEEEEEEE
Confidence            34457899999999999999999863

>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ...

Probab=96.11  E-value=0.00056  Score=43.09  Aligned_cols=22  Identities=23%  Similarity=0.345  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         5 ~~y~~~~~lg~G~~g~V~~~~~   26 (283)
T 3bhy_A            5 DHYEMGEELGSGQFAIVRKCRQ   26 (283)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEE
T ss_pred             hhhhhHHhhcccCceEEEEEEE
Confidence            4689999999999999999863

>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens}

Probab=96.11  E-value=0.00069  Score=44.33  Aligned_cols=21  Identities=19%  Similarity=0.339  Sum_probs=19.1

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|.+.+.||+|+||.||+|.
T Consensus        11 ~~y~~~~~lG~G~~g~V~~~~   31 (326)
T 2y0a_A           11 DYYDTGEELGSGQFAVVKKCR   31 (326)
T ss_dssp             HHEEEEEEEECCSSEEEEEEE
T ss_pred             cceEeceEEeeCCCeEEEEEE
Confidence            568999999999999999986

>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens}

Probab=96.10  E-value=0.00079  Score=44.22  Aligned_cols=23  Identities=9%  Similarity=-0.054  Sum_probs=20.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -++|.+.+.||+|+||.||+|.+
T Consensus        41 ~~~y~~~~~lg~G~~g~Vy~~~~   63 (352)
T 2jii_A           41 GRQWKLKSFQTRDNQGILYEAAP   63 (352)
T ss_dssp             SCEEEEEEEEEEETTEEEEEEEE
T ss_pred             CCeEEEEEEecCCCCeEEEEEee
Confidence            47899999999999999999863

>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A*

Probab=96.09  E-value=0.00045  Score=43.54  Aligned_cols=22  Identities=27%  Similarity=0.566  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|.+.+.||+|+||.||+|.+
T Consensus         9 ~~y~~~~~lg~G~~g~V~~~~~   30 (277)
T 3f3z_A            9 QYYTLENTIGRGSWGEVKIAVQ   30 (277)
T ss_dssp             HHEEEEEEEEEETTEEEEEEEE
T ss_pred             hhEEeeeEEeecCCEEEEEEEe
Confidence            4688999999999999999863

>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A

Probab=96.08  E-value=0.0006  Score=43.68  Aligned_cols=22  Identities=32%  Similarity=0.448  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         9 ~~y~~~~~lg~G~~g~V~~~~~   30 (304)
T 2jam_A            9 KTFIFMEVLGSGAFSEVFLVKQ   30 (304)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEE
T ss_pred             ccceeeeeccCCCCceEEEEEE
Confidence            5789999999999999999863

>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens}

Probab=96.05  E-value=0.00062  Score=47.16  Aligned_cols=21  Identities=24%  Similarity=0.648  Sum_probs=17.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||+|.
T Consensus        11 ~~Y~i~~~LG~G~fg~V~~~~   31 (444)
T 3soa_A           11 EEYQLFEELGKGAFSVVRRCV   31 (444)
T ss_dssp             HHEEEEEEEEEC--CEEEEEE
T ss_pred             CCeEEEEEeccCCCeEEEEEE
Confidence            579999999999999999985

>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A*

Probab=96.00  E-value=0.00072  Score=44.20  Aligned_cols=25  Identities=20%  Similarity=0.462  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...++|.+.+.||+|+||.||+|.+
T Consensus        38 ~~~~~y~~~~~lg~G~~g~Vy~~~~   62 (335)
T 2owb_A           38 RSRRRYVRGRFLGKGGFAKCFEISD   62 (335)
T ss_dssp             TTTEEEEEEEEEEEETTEEEEEEEE
T ss_pred             ccCCceEEEEEEeeCCCeEEEEEEE
Confidence            3456899999999999999999863

>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A*

Probab=95.95  E-value=0.00098  Score=43.77  Aligned_cols=23  Identities=26%  Similarity=0.472  Sum_probs=19.5

Q ss_pred             CCCCCccc-cccCCccceEeeecC
Q psy17601         42 VEDFEPLK-VIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~-~iG~G~fG~V~La~~   64 (64)
                      .++|.+++ +||+|+||.||+|.+
T Consensus        27 ~~~y~i~~~~lG~G~~g~V~~~~~   50 (336)
T 3fhr_A           27 TDDYQLSKQVLGLGVNGKVLECFH   50 (336)
T ss_dssp             GGTEEEEEEEEEEETTEEEEEEEE
T ss_pred             cceeEecceeeeeCCCeEEEEEEE
Confidence            37899866 799999999999863

>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A

Probab=95.95  E-value=0.0012  Score=45.90  Aligned_cols=23  Identities=22%  Similarity=0.397  Sum_probs=20.0

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+.+.||+|+||.||+|.
T Consensus       218 ~~~~~~~~~~lG~G~fg~Vy~~~  240 (495)
T 1opk_A          218 ERTDITMKHKLGGGQYGEVYEGV  240 (495)
T ss_dssp             CGGGEEEEEESGGGTTSSEEEEE
T ss_pred             CHHHceeeeEecCCCCeEEEEEE
Confidence            45678889999999999999985

>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A*

Probab=95.94  E-value=0.0014  Score=42.70  Aligned_cols=16  Identities=19%  Similarity=0.235  Sum_probs=14.6

Q ss_pred             ccccCCccceEeeecC
Q psy17601         49 KVIGRGAFGECPKKID   64 (64)
Q Consensus        49 ~~iG~G~fG~V~La~~   64 (64)
                      +.||.|+||.||+|.+
T Consensus        96 ~~iG~G~~g~Vy~~~~  111 (282)
T 1zar_A           96 KLMGEGKESAVFNCYS  111 (282)
T ss_dssp             EEEEECSSEEEEEEEE
T ss_pred             CEeccCCCceEEEEEe
Confidence            9999999999999863

>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A*

Probab=95.91  E-value=0.0006  Score=43.33  Aligned_cols=22  Identities=36%  Similarity=0.682  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus        22 ~~y~i~~~lg~G~~g~V~~~~~   43 (287)
T 2wei_A           22 ERYNIVCMLGKGSFGEVLKCKD   43 (287)
T ss_dssp             HHEEEEEEEEEETTEEEEEEEE
T ss_pred             hcceeeEEEcCCCCEEEEEEEE
Confidence            5699999999999999999863

>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ...

Probab=95.88  E-value=0.0011  Score=42.21  Aligned_cols=23  Identities=30%  Similarity=0.271  Sum_probs=19.8

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ....|.+.+.||+|+||.||+|.
T Consensus        23 ~~~~y~~~~~lg~G~~g~Vy~~~   45 (298)
T 3f66_A           23 SSLIVHFNEVIGRGHFGCVYHGT   45 (298)
T ss_dssp             GGEEEEEEEEEEEETTEEEEEEE
T ss_pred             cceehhhcceeeecCCceEEEEE
Confidence            34568889999999999999985

>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A*

Probab=95.86  E-value=0.0017  Score=47.05  Aligned_cols=24  Identities=33%  Similarity=0.566  Sum_probs=20.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus       387 i~~~~y~i~~~LG~G~fG~Vy~a~  410 (656)
T 2j0j_A          387 IQRERIELGRCIGEGQFGDVHQGI  410 (656)
T ss_dssp             CCGGGEEEEEEEECCSSCCEEEEE
T ss_pred             cccccEEEeeEEeeCCCEEEEEEE
Confidence            344678888999999999999985

>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A*

Probab=95.86  E-value=0.0014  Score=43.49  Aligned_cols=21  Identities=33%  Similarity=0.506  Sum_probs=18.9

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|..++.||+|+||.||+|.
T Consensus        54 ~~y~~~~~lG~G~~g~Vy~a~   74 (348)
T 1u5q_A           54 KLFSDLREIGHGSFGAVYFAR   74 (348)
T ss_dssp             HHEEEEEEEEECSSEEEEEEE
T ss_pred             hheeeeeEEccCCCEEEEEEE
Confidence            458899999999999999986

>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii}

Probab=95.86  E-value=0.00094  Score=45.33  Aligned_cols=22  Identities=14%  Similarity=0.045  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|...++||+|+||.||+|.|
T Consensus        78 ~~~~~~~~LG~G~fG~Vy~a~~   99 (413)
T 3dzo_A           78 RTLVRGTVLGQEDPYAYLEATD   99 (413)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEE
T ss_pred             eeEEEecccccCCCEEEEEEEe
Confidence            4577788999999999999974

>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B*

Probab=95.80  E-value=0.0012  Score=43.83  Aligned_cols=25  Identities=24%  Similarity=0.174  Sum_probs=22.1

Q ss_pred             CCCCCCCccccccCC--ccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRG--AFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G--~fG~V~La~~   64 (64)
                      ...++|++++.||+|  +||.||+|.+
T Consensus        22 ~~~~~y~~~~~lG~G~~~~g~V~~~~~   48 (389)
T 3gni_B           22 PEGGCYELLTVIGKGFEDLMTVNLARY   48 (389)
T ss_dssp             CCGGGEEEEEEEEEETTTTEEEEEEEE
T ss_pred             CCCCcEEEEecccCCcCCceEEEEEEE
Confidence            356899999999999  9999999864

>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B

Probab=95.77  E-value=0.00077  Score=45.03  Aligned_cols=21  Identities=19%  Similarity=0.585  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||+|.
T Consensus        29 ~~y~~~~~lG~G~~g~V~~~~   49 (362)
T 2bdw_A           29 DNYDVKEELGKGAFSVVRRCV   49 (362)
T ss_dssp             HHEEEEEEEEEETTEEEEEEE
T ss_pred             cCeEEeeEEecCCCeEEEEEE
Confidence            579999999999999999986

>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ...

Probab=95.77  E-value=0.0017  Score=44.47  Aligned_cols=24  Identities=25%  Similarity=0.339  Sum_probs=20.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus       181 i~~~~~~~~~~lG~G~fg~Vy~~~  204 (452)
T 1fmk_A          181 IPRESLRLEVKLGQGCFGEVWMGT  204 (452)
T ss_dssp             CCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             cChhHceeeeeecCCCCeEEEEEE
Confidence            344678888999999999999985

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*

Probab=95.76  E-value=0.0008  Score=46.13  Aligned_cols=22  Identities=32%  Similarity=0.662  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||+|+||.||+|.+
T Consensus        26 ~~y~~~~~lg~G~~g~V~~~~~   47 (484)
T 3nyv_A           26 DRYKGQRVLGKGSFGEVILCKD   47 (484)
T ss_dssp             HHEEEEEEEEEETTEEEEEEEE
T ss_pred             CceEEeeEEecCCCEEEEEEEE
Confidence            5799999999999999999863

>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A*

Probab=95.73  E-value=0.0019  Score=41.06  Aligned_cols=26  Identities=23%  Similarity=0.280  Sum_probs=21.9

Q ss_pred             cCCCCCCCCccc-cccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLK-VIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~-~iG~G~fG~V~La~   63 (64)
                      ..+..++|.+.. .||+|+||.||+|.
T Consensus        11 ~~~~~~~y~~~~~~lg~G~~g~Vy~~~   37 (291)
T 1xbb_A           11 VYLDRKLLTLEDKELGSGNFGTVKKGY   37 (291)
T ss_dssp             CBCCGGGEEEEEEEEEECSSEEEEEEE
T ss_pred             eeecchhhhhccCccccccCeeeEeee
Confidence            345667899988 99999999999983

>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=95.63  E-value=0.0024  Score=40.51  Aligned_cols=24  Identities=21%  Similarity=0.414  Sum_probs=20.6

Q ss_pred             CCCCCCCccc-cccCCccceEeeec
Q psy17601         40 LGVEDFEPLK-VIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~-~iG~G~fG~V~La~   63 (64)
                      +..++|.++. .||+|+||.||+|.
T Consensus         6 ~~~~~~~i~~~~lg~G~~g~Vy~~~   30 (287)
T 1u59_A            6 LKRDNLLIADIELGCGNFGSVRQGV   30 (287)
T ss_dssp             CCGGGEEEEEEEEECCTTEEEEEEE
T ss_pred             ccHHHhhhhhccccccCceeEEEeE
Confidence            4567888887 99999999999985

>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A

Probab=95.61  E-value=0.002  Score=40.79  Aligned_cols=23  Identities=30%  Similarity=0.281  Sum_probs=19.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -..|.+.+.||+|+||.||+|.+
T Consensus        25 ~~~~~~~~~lg~G~~g~Vy~~~~   47 (290)
T 1t4h_A           25 GRFLKFDIEIGRGSFKTVYKGLD   47 (290)
T ss_dssp             SCEEEEEEEEEECSSEEEEEEEE
T ss_pred             ceeEEeeeeccCCCCeEEEEeEe
Confidence            34578888999999999999853

>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7

Probab=95.59  E-value=0.0021  Score=45.14  Aligned_cols=24  Identities=25%  Similarity=0.339  Sum_probs=20.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus       264 i~~~~~~~~~~lG~G~fg~Vy~~~  287 (535)
T 2h8h_A          264 IPRESLRLEVKLGQGCFGEVWMGT  287 (535)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             cchhhhhhheecccCCCeEEEEEE
Confidence            344678888899999999999985

>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A*

Probab=95.49  E-value=0.0024  Score=40.83  Aligned_cols=20  Identities=15%  Similarity=-0.144  Sum_probs=17.4

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |.+...||+|+||.||+|.+
T Consensus        49 ~~i~~~ig~G~~g~Vy~a~~   68 (258)
T 1zth_A           49 TAMGGVISTGKEANVFYADG   68 (258)
T ss_dssp             EEEEEEEEECSSEEEEEEEE
T ss_pred             hhhCCEEeecceEEEEEEEE
Confidence            56788999999999999863

>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7

Probab=95.49  E-value=0.0018  Score=40.87  Aligned_cols=20  Identities=30%  Similarity=0.373  Sum_probs=16.7

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.+.+.||+|+||.||+|.
T Consensus        22 ~~~~~~~lg~G~~g~Vy~~~   41 (298)
T 3pls_A           22 VTHSDRVIGKGHFGVVYHGE   41 (298)
T ss_dssp             EEEEEEEEEEETTEEEEEEE
T ss_pred             EEccCceeccCCCceEEEEE
Confidence            35556899999999999985

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}

Probab=95.48  E-value=0.0021  Score=46.22  Aligned_cols=22  Identities=23%  Similarity=0.321  Sum_probs=20.2

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.|
T Consensus        80 ~~y~i~~~lg~G~~g~Vy~a~~  101 (681)
T 2pzi_A           80 GQYEVKGCIAHGGLGWIYLALD  101 (681)
T ss_dssp             TTEEEEEEEEEETTEEEEEEEE
T ss_pred             CceEEEEEEeeCCCeEEEEEEE
Confidence            6899999999999999999863

>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A*

Probab=95.44  E-value=0.0014  Score=42.28  Aligned_cols=21  Identities=29%  Similarity=0.427  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||+|+||.||+|.
T Consensus        42 ~~y~~~~~lg~G~~g~Vy~~~   62 (342)
T 1b6c_B           42 RTIVLQESIGKGRFGEVWRGK   62 (342)
T ss_dssp             HHCEEEEEEEEETTEEEEEEE
T ss_pred             ccEEEEeeecCCCCcEEEEEE
Confidence            579999999999999999985

>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A*

Probab=95.40  E-value=0.0033  Score=40.69  Aligned_cols=21  Identities=19%  Similarity=0.441  Sum_probs=17.8

Q ss_pred             CCCCCccccccCCccceEeee
Q psy17601         42 VEDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La   62 (64)
                      -..|.+++.||+|+||.||++
T Consensus        30 ~r~~~~~~~lG~G~~g~V~~~   50 (318)
T 3lxp_A           30 KRYLKKIRDLGEGHFGKVSLY   50 (318)
T ss_dssp             GGGEEEEEEEEECSSEEEEEE
T ss_pred             HHHHhhhheecCCCCeEEEEE
Confidence            344599999999999999876

>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7

Probab=95.38  E-value=0.0034  Score=42.16  Aligned_cols=20  Identities=35%  Similarity=0.368  Sum_probs=17.0

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.+.+.||+|+||.||+|.
T Consensus        90 ~~~~~~~LG~G~fg~Vy~~~  109 (373)
T 3c1x_A           90 IVHFNEVIGRGHFGCVYHGT  109 (373)
T ss_dssp             EEEEEEEEECCSSSEEEEEE
T ss_pred             eeecCcEeeeCCCeEEEEEE
Confidence            35667899999999999875

>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A

Probab=95.30  E-value=0.0023  Score=42.58  Aligned_cols=22  Identities=27%  Similarity=0.601  Sum_probs=19.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||.|+||.||+|.+
T Consensus        94 ~~y~~~~~lg~G~~g~Vy~a~~  115 (365)
T 2y7j_A           94 QKYDPKDVIGRGVSSVVRRCVH  115 (365)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEE
T ss_pred             hhcccceEEecCCCEEEEEEEE
Confidence            4688889999999999999863

>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A*

Probab=95.30  E-value=0.0044  Score=45.86  Aligned_cols=24  Identities=25%  Similarity=0.387  Sum_probs=17.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+.+.||+|+||.||+|.+
T Consensus        12 ~~grY~i~~~LG~G~fG~Vyla~~   35 (676)
T 3qa8_A           12 TCGPWEMKERLGTGGFGYVLRWIH   35 (676)
T ss_dssp             -----CCCCCCCBCSSSBCCCCCC
T ss_pred             CCCCeEEEEEEeeCCCeEEEEEEE
Confidence            458899999999999999999864

>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A*

Probab=94.98  E-value=0.0091  Score=37.95  Aligned_cols=19  Identities=26%  Similarity=0.263  Sum_probs=15.6

Q ss_pred             CccccccCCccceEeeecC
Q psy17601         46 EPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        46 ~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+.||+|+||.||+|.+
T Consensus        34 ~~~~~lg~G~~g~Vy~~~~   52 (307)
T 2nru_A           34 VGGNKMGEGGFGVVYKGYV   52 (307)
T ss_dssp             TTCCEEEECSSEEEEEEES
T ss_pred             ccCCccccCCCeEEEEEEE
Confidence            3348999999999999863

>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A*

Probab=94.90  E-value=0.0036  Score=40.80  Aligned_cols=20  Identities=20%  Similarity=0.170  Sum_probs=17.5

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.....||+|+||.||+|.
T Consensus        46 ~~~~~~~lg~G~~g~V~~a~   65 (321)
T 2c30_A           46 LLDSYVKIGEGSTGIVCLAR   65 (321)
T ss_dssp             HEEEEEEEEEETTEEEEEEE
T ss_pred             hhhccEEeccCCCeEEEEEE
Confidence            37777899999999999986

>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A

Probab=94.88  E-value=0.0071  Score=42.37  Aligned_cols=20  Identities=20%  Similarity=0.132  Sum_probs=17.9

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |.+...||.|+||.||+|.+
T Consensus        97 Y~I~~~IG~Gk~a~VY~a~d  116 (397)
T 4gyi_A           97 YSVGSRIGVGKESDIMIVAD  116 (397)
T ss_dssp             SEEEEEEEECSSEEEEEEEC
T ss_pred             EEecCEeeeCCceEEEEEEC
Confidence            77788999999999999974

>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A*

Probab=94.81  E-value=0.0039  Score=40.56  Aligned_cols=19  Identities=32%  Similarity=0.489  Sum_probs=15.8

Q ss_pred             CCcc-ccccCCccceEeeec
Q psy17601         45 FEPL-KVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~-~~iG~G~fG~V~La~   63 (64)
                      |.+. +.||+|+||.||+|.
T Consensus        30 y~~~~~~lG~G~~g~V~~~~   49 (327)
T 3lm5_A           30 YILTSKELGRGKFAVVRQCI   49 (327)
T ss_dssp             EEEEEEEEEEETTEEEEEEE
T ss_pred             EeeccceeCCCCCeEEEEEE
Confidence            4444 789999999999985

>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A

Probab=94.80  E-value=0.0043  Score=40.56  Aligned_cols=16  Identities=38%  Similarity=0.794  Sum_probs=14.3

Q ss_pred             ccccCCccceEeeecC
Q psy17601         49 KVIGRGAFGECPKKID   64 (64)
Q Consensus        49 ~~iG~G~fG~V~La~~   64 (64)
                      +.||+|+||.||+|.+
T Consensus        17 ~~lG~G~~g~V~~~~~   32 (325)
T 3kn6_A           17 KPLGEGSFSICRKCVH   32 (325)
T ss_dssp             CCSEEETTEEEEEEEE
T ss_pred             CccccCCCeEEEEEEE
Confidence            6899999999999863

>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens}

Probab=94.21  E-value=0.012  Score=39.36  Aligned_cols=21  Identities=33%  Similarity=0.455  Sum_probs=11.7

Q ss_pred             CCCCc-cccccCCccceEeeec
Q psy17601         43 EDFEP-LKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~-~~~iG~G~fG~V~La~   63 (64)
                      +.|++ -+.||+|+||.||+|.
T Consensus        20 ~~y~~~g~~lG~G~~g~Vy~~~   41 (405)
T 3rgf_A           20 DLFEYEGCKVGRGTYGHVYKAK   41 (405)
T ss_dssp             HHEECSSCCCC-----EEEEEE
T ss_pred             hhhhhcCcEeeecCCeEEEEEE
Confidence            34665 3479999999999986

>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens}

Probab=94.02  E-value=0.0099  Score=39.82  Aligned_cols=16  Identities=31%  Similarity=0.611  Sum_probs=9.1

Q ss_pred             cccccCCccceEeeec
Q psy17601         48 LKVIGRGAFGECPKKI   63 (64)
Q Consensus        48 ~~~iG~G~fG~V~La~   63 (64)
                      .++||+|+||.||+|.
T Consensus        94 ~~~lG~G~~g~Vy~a~  109 (373)
T 2x4f_A           94 TEILGGGRFGQVHKCE  109 (373)
T ss_dssp             EEECC-----CEEEEE
T ss_pred             ceEEecCcCEEEEEEE
Confidence            4579999999999985

>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens}

Probab=93.22  E-value=0.022  Score=40.78  Aligned_cols=19  Identities=21%  Similarity=0.420  Sum_probs=14.6

Q ss_pred             CCccc-cccCCccceEeeec
Q psy17601         45 FEPLK-VIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~-~iG~G~fG~V~La~   63 (64)
                      +.+.. .||+|+||.||+|.
T Consensus       337 ~~~~~~~LG~G~fG~Vy~~~  356 (613)
T 2ozo_A          337 LLIADIELGCGNFGSVRQGV  356 (613)
T ss_dssp             EEEEEEEEEECSSSEEEEEE
T ss_pred             eeEcCcEEecCCCcEEEEEE
Confidence            33344 69999999999874

>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A*

Probab=92.79  E-value=0.041  Score=37.40  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=17.2

Q ss_pred             CCCCCCCc-cccccCCccceEeee
Q psy17601         40 LGVEDFEP-LKVIGRGAFGECPKK   62 (64)
Q Consensus        40 ~~~~dF~~-~~~iG~G~fG~V~La   62 (64)
                      ..+.++.+ .++||+|+||.|+++
T Consensus        11 ~~l~~~~~~~~~LG~G~~g~V~~~   34 (434)
T 2rio_A           11 QSLKNLVVSEKILGYGSSGTVVFQ   34 (434)
T ss_dssp             CSCSSCEEEEEEEEECSTTCEEEE
T ss_pred             hhhhheeeccCeEeeCCCeEEEEE
Confidence            34555555 478999999999765

>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens}

Probab=90.97  E-value=0.041  Score=37.67  Aligned_cols=22  Identities=36%  Similarity=0.524  Sum_probs=18.0

Q ss_pred             CCCCCCCccccccCCccceEee
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPK   61 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~L   61 (64)
                      +...+|.+.++||+|+||.|+.
T Consensus        21 i~~~~y~~~~~LG~G~~G~V~~   42 (432)
T 3p23_A           21 VGKISFCPKDVLGHGAEGTIVY   42 (432)
T ss_dssp             ETTEEEEEEEEEEECGGGCEEE
T ss_pred             EccEEEecCCeeecCcCEEEEE
Confidence            3445799999999999999754

>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A*

Probab=90.70  E-value=0.057  Score=38.90  Aligned_cols=14  Identities=36%  Similarity=0.665  Sum_probs=12.6

Q ss_pred             cccCCccceEeeec
Q psy17601         50 VIGRGAFGECPKKI   63 (64)
Q Consensus        50 ~iG~G~fG~V~La~   63 (64)
                      .||+|+||.||+|.
T Consensus       376 ~LG~G~fG~Vy~~~  389 (635)
T 4fl3_A          376 ELGSGNFGTVKKGY  389 (635)
T ss_dssp             EEEECSSEEEEEEE
T ss_pred             EeccCCCEEEEEEE
Confidence            69999999999883

>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*

Probab=86.73  E-value=0.2  Score=35.42  Aligned_cols=15  Identities=27%  Similarity=0.505  Sum_probs=7.3

Q ss_pred             cccccCCccceEeee
Q psy17601         48 LKVIGRGAFGECPKK   62 (64)
Q Consensus        48 ~~~iG~G~fG~V~La   62 (64)
                      .+.||+|+||.||+|
T Consensus       341 ~~~LG~G~fg~Vy~~  355 (540)
T 3en9_A          341 EHLIGKGAEADIKRD  355 (540)
T ss_dssp             -------CCEEEEEE
T ss_pred             CCEEeeCCCEEEEEE
Confidence            358999999999976

>1psb_C NDR Ser/Thr kinase-like protein; helix-loop-helix, protein-peptide complex, metal binding protein; NMR {Bos taurus}

Probab=86.71  E-value=0.015  Score=25.96  Aligned_cols=20  Identities=75%  Similarity=1.149  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHhhhccCCCC
Q psy17601         23 QQHAQKETEFLRLKRSRLGV   42 (64)
Q Consensus        23 ~~~~~~e~~~~r~~~~~~~~   42 (64)
                      +.+.++|++|+|+.+.++.+
T Consensus         6 ~~~~~kEte~lRl~R~Kl~~   25 (26)
T 1psb_C            6 SAHARKETEFLRLKRTRLGL   25 (26)
T ss_dssp             CCSCCTTHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHhhcccCC
Confidence            44567899999998877654

>1l6x_B Minimized B-domain of protein A Z34C; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: k.13.1.1 PDB: 1oqo_C* 1oqx_C* 1zdc_A 1zdd_A

Probab=81.23  E-value=2.2  Score=20.30  Aligned_cols=24  Identities=33%  Similarity=0.454  Sum_probs=18.9

Q ss_pred             HHHHHHhcCCCCHHHHHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKRQQHA   26 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~~~~   26 (64)
                      ..=+.|...+|+|++|+.+.+.+.
T Consensus         8 aFYevLh~~nLtEeQrn~yI~slk   31 (34)
T 1l6x_B            8 RFYEALHDPNLNEEQRNAKIKSIR   31 (34)
T ss_dssp             HHHHHHHCTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHcCCCCCHHHHHhHHHHHh
Confidence            344678999999999998877653

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Length	Definition	E-value
Query	64
d1vzoa_	322	d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5	1e-04
d1rdqe_	350	d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni	4e-04
d1nvra_	271	d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {	0.002
d1o6la_	337	d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap	0.002
d2java1	269	d.144.1.7 (A:3-271) Serine/threonine-protein kinas	0.002

>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Ribosomal protein S6 kinase alpha 5, Msk1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.2 bits (80), Expect = 1e-04
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 24 QHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
          +H  +    L     ++G+E+FE LKV+G GA+G+
Sbjct: 6  KHELRTAN-LTGHAEKVGIENFELLKVLGTGAYGK 39

>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 34.0 bits (77), Expect = 4e-04
 Identities = 13/57 (22%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 2  AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGE 58
          A  ++  + ES+ E   + K     + ET      ++   ++ F+ +K +G G+FG 
Sbjct: 4  AAAKKGSEQESVKEFLAKAKEDFLKKWETP----SQNTAQLDQFDRIKTLGTGSFGR 56

>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.9 bits (72), Expect = 0.002
 Identities = 8/17 (47%), Positives = 14/17 (82%)

Query: 42 VEDFEPLKVIGRGAFGE 58
          VED++ ++ +G GA+GE
Sbjct: 4  VEDWDLVQTLGEGAYGE 20

>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 32.1 bits (72), Expect = 0.002
 Identities = 8/20 (40%), Positives = 16/20 (80%)

Query: 39 RLGVEDFEPLKVIGRGAFGE 58
          ++ + DF+ LK++G+G FG+
Sbjct: 1  KVTMNDFDYLKLLGKGTFGK 20

>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine-protein kinase Nek2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 31.9 bits (72), Expect = 0.002
 Identities = 9/17 (52%), Positives = 12/17 (70%)

Query: 43 EDFEPLKVIGRGAFGEC 59
          ED+E L  IG G++G C
Sbjct: 4  EDYEVLYTIGTGSYGRC 20

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	64
d1o6la_	337	Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9	98.22
d1rdqe_	350	cAMP-dependent PK, catalytic subunit {Mouse (Mus m	98.13
d1omwa3	364	G-protein coupled receptor kinase 2 {Cow (Bos taur	98.1
d1vzoa_	322	Ribosomal protein S6 kinase alpha 5, Msk1 {Human (	98.1
d2j4za1	263	Aurora-related kinase 1 (aurora-2) {Human (Homo sa	98.04
d1uu3a_	288	3-phosphoinositide dependent protein kinase-1 Pdk1	98.0
d1fota_	316	cAMP-dependent PK, catalytic subunit {Baker's yeas	97.97
d1gz8a_	298	Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T	97.96
d1unla_	292	Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T	97.96
d1k2pa_	258	Bruton's tyrosine kinase (Btk) {Human (Homo sapien	97.9
d1xjda_	320	Protein kinase C, theta type {Human (Homo sapiens)	97.89
d2java1	269	Serine/threonine-protein kinase Nek2 {Human (Homo	97.87
d1xkka_	317	EGF receptor tyrosine kinase, Erbb-1 {Human (Homo	97.86
d1ob3a_	286	Cyclin-dependent PK, CDK2 {(Plasmodium falciparum)	97.83
d3bqca1	328	Protein kinase CK2, alpha subunit {Rattus norvegic	97.83
d1s9ja_	322	Dual specificity mitogen-activated protein kinase	97.78
d1blxa_	305	Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T	97.77
d1sm2a_	263	Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie	97.76
d2b1pa1	355	c-jun N-terminal kinase (jnk3s) {Human (Homo sapie	97.76
d1fvra_	309	Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}	97.75
d1nvra_	271	Cell cycle checkpoint kinase chk1 {Human (Homo sap	97.75
d1jksa_	293	Death-associated protein kinase, Dap {Human (Homo	97.73
d1lufa_	301	Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax	97.72
d1ywna1	299	Vascular endothelial growth factor receptor 2 (kdr	97.69
d1rjba_	325	Fl cytokine receptor {Human (Homo sapiens) [TaxId:	97.69
d1koaa2	350	Twitchin, kinase domain {Caenorhabditis elegans, p	97.69
d3blha1	318	Cell division protein kinase 9, CDK9 {Human (Homo	97.68
d1q5ka_	350	Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho	97.67
d2gfsa1	348	MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]	97.65
d1mqba_	283	epha2 receptor tyrosine kinase {Human (Homo sapien	97.63
d1opja_	287	Abelsone tyrosine kinase (abl) {Mouse (Mus musculu	97.62
d1u46a_	273	Activated CDC42 kinase 1, ACK1 {Human (Homo sapien	97.62
d1fgka_	299	Fibroblast growth factor receptor 1 {Human (Homo s	97.62
d1cm8a_	346	MAP kinase p38-gamma {Human (Homo sapiens) [TaxId:	97.61
d1yhwa1	293	pak1 {Human (Homo sapiens) [TaxId: 9606]}	97.61
d1o6ya_	277	Mycobacterial protein kinase PknB, catalytic domai	97.61
d1mp8a_	273	Focal adhesion kinase 1 (fak) {Human (Homo sapiens	97.59
d1phka_	277	gamma-subunit of glycogen phosphorylase kinase (Ph	97.58
d2ozaa1	335	MAP kinase activated protein kinase 2, mapkap2 {Hu	97.58
d1ckia_	299	Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax	97.57
d1csna_	293	Casein kinase-1, CK1 {Fission yeast (Schizosacchar	97.56
d1xwsa_	273	Proto-oncogene serine/threonine-protein kinase Pim	97.55
d1tkia_	321	Titin, kinase domain {Human (Homo sapiens) [TaxId:	97.55
d1koba_	352	Twitchin, kinase domain {California sea hare (Aply	97.55
d1a06a_	307	Calmodulin-dependent protein kinase {Rat (Rattus n	97.54
d1uwha_	276	B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}	97.5
d1p4oa_	308	Insulin-like growth factor 1 receptor {Human (Homo	97.49
d1byga_	262	Carboxyl-terminal src kinase (csk) {Human (Homo sa	97.48
d2jfla1	288	STE20-like serine/threonine-protein kinase, SLK {H	97.43
d1pmea_	345	MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606	97.43
d1jpaa_	299	ephb2 receptor tyrosine kinase {Mouse (Mus musculu	97.42
d1qpca_	272	Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax	97.41
d1u5ra_	309	Serine/threonine protein kinase TAO2 {Rat (Rattus	97.38
d1q8ya_	362	Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T	97.32
d1fmka3	285	c-src tyrosine kinase {Human (Homo sapiens) [TaxId	97.27
d1t46a_	311	c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]	97.24
d1u59a_	285	Tyrosine-protein kinase ZAP-70 {Human (Homo sapien	96.79
d1t4ha_	270	Protein kinase wnk1 {Human (Homo sapiens) [TaxId:	96.53
d1vjya_	303	Type I TGF-beta receptor R4 {Human (Homo sapiens)	96.43
d1xbba_	277	Tyrosine-protein kinase SYK {Human (Homo sapiens)	96.04
d1r0pa_	311	Hepatocyte growth factor receptor, c-MET {Human (H	95.88

>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.22  E-value=7.9e-08  Score=63.49  Aligned_cols=26  Identities=31%  Similarity=0.695  Sum_probs=23.9

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++++||++++.||+|+||+||+|++
T Consensus         1 ~i~l~dy~~~~~lG~G~fg~V~~~~~   26 (337)
T d1o6la_           1 KVTMNDFDYLKLLGKGTFGKVILVRE   26 (337)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEEE
T ss_pred             CCchHhcEEEEEEecCcCeEEEEEEE
Confidence            57899999999999999999999973

>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.13  E-value=4.1e-07  Score=60.07  Aligned_cols=44  Identities=20%  Similarity=0.459  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHhh----hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         21 KRQQHAQKETEFLRL----KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        21 ~~~~~~~~e~~~~r~----~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ......+....+...    ......+++|++++.||+|+||+||+|++
T Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~ld~y~i~~~lG~G~fg~Vy~a~~   62 (350)
T d1rdqe_          15 VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKH   62 (350)
T ss_dssp             HHHHHHHHHHHHHHHHHSCCCCCCCGGGEEEEEEEEECSSCEEEEEEE
T ss_pred             HHHHHHHHHHHHHhhccccccCCCCccCeEEEEEeecCcCcEEEEEEE
Confidence            334444444444432    22345679999999999999999999963

>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: G-protein coupled receptor kinase 2
species: Cow (Bos taurus) [TaxId: 9913]

Probab=98.10  E-value=2.6e-07  Score=61.30  Aligned_cols=25  Identities=40%  Similarity=0.668  Sum_probs=22.8

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++++||+++++||+|+||+||+|.+
T Consensus         1 lslddy~i~~~lG~G~fg~Vy~~~~   25 (364)
T d1omwa3           1 LTMNDFSVHRIIGRGGFGEVYGCRK   25 (364)
T ss_dssp             CCSTTEEEEEEEEECSSCEEEEEEE
T ss_pred             CCHHhCeeeeEEecCCCeEEEEEEE
Confidence            4789999999999999999999963

>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Ribosomal protein S6 kinase alpha 5, Msk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.10  E-value=2e-07  Score=60.78  Aligned_cols=27  Identities=41%  Similarity=0.736  Sum_probs=24.4

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++++||++++.||+|+||+||+|.
T Consensus        18 ~~~~~l~~y~~~~~IG~G~fg~Vy~~~   44 (322)
T d1vzoa_          18 AEKVGIENFELLKVLGTGAYGKVFLVR   44 (322)
T ss_dssp             CCCCCGGGEEEEEEEEETTTEEEEEEE
T ss_pred             CcccchhceEEEEEEecCCCeEEEEEE
Confidence            446789999999999999999999985

>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.04  E-value=3.3e-07  Score=58.40  Aligned_cols=26  Identities=31%  Similarity=0.557  Sum_probs=23.7

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.+++||++++.||+|+||+||+|.+
T Consensus         2 ~~~l~dy~i~~~iG~G~fg~Vy~~~~   27 (263)
T d2j4za1           2 QWALEDFEIGRPLGKGKFGNVYLARE   27 (263)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEEE
T ss_pred             CcchhHeEEEEEEecCCCcEEEEEEE
Confidence            56789999999999999999999964

>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: 3-phosphoinositide dependent protein kinase-1 Pdk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.00  E-value=4.4e-07  Score=58.53  Aligned_cols=27  Identities=26%  Similarity=0.409  Sum_probs=23.7

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+...+||+++++||+|+||+||+|.+
T Consensus         3 ~~~~p~dy~i~~~lG~G~fg~Vy~a~~   29 (288)
T d1uu3a_           3 RKKRPEDFKFGKILGEGSFSTVVLARE   29 (288)
T ss_dssp             CCCCGGGEEEEEEEEECSSCEEEEEEE
T ss_pred             CCCCCCCCEEEEEEeeCCCeEEEEEEE
Confidence            356679999999999999999999963

>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.97  E-value=5e-07  Score=58.84  Aligned_cols=24  Identities=29%  Similarity=0.627  Sum_probs=22.1

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++||++++.||+|+||+||+|.+
T Consensus         2 sl~dy~i~~~lG~G~fg~Vy~a~~   25 (316)
T d1fota_           2 SLQDFQILRTLGTGSFGRVHLIRS   25 (316)
T ss_dssp             CGGGEEEEEEEEECSSCEEEEEEE
T ss_pred             chhHeEEEEEEecCcCcEEEEEEE
Confidence            678999999999999999999963

>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.96  E-value=6e-07  Score=57.38  Aligned_cols=23  Identities=30%  Similarity=0.642  Sum_probs=21.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||+||+|.+
T Consensus         1 ~d~Y~~~~~lG~G~fg~Vy~~~~   23 (298)
T d1gz8a_           1 MENFQKVEKIGEGTYGVVYKARN   23 (298)
T ss_dssp             CTTEEEEEEEEECSSSEEEEEEE
T ss_pred             CCCCEeccEEecCcCeEEEEEEE
Confidence            58999999999999999999964

>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.96  E-value=6.1e-07  Score=56.37  Aligned_cols=23  Identities=30%  Similarity=0.642  Sum_probs=21.0

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||+||+|.|
T Consensus         1 ~~ry~~i~~LG~G~fg~V~~~~~   23 (292)
T d1unla_           1 MQKYEKLEKIGEGTYGTVFKAKN   23 (292)
T ss_dssp             CCSEEEEEEEEECSSSEEEEEEE
T ss_pred             CCCCEeeeEEecCcCeEEEEEEE
Confidence            47899999999999999999974

>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Bruton's tyrosine kinase (Btk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.90  E-value=1.6e-06  Score=54.84  Aligned_cols=24  Identities=29%  Similarity=0.443  Sum_probs=21.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.+||++++.||+|+||+||+|.
T Consensus         1 ~~~~~~~~~~~iG~G~fg~Vy~~~   24 (258)
T d1k2pa_           1 IDPKDLTFLKELGTGQFGVVKYGK   24 (258)
T ss_dssp             CCCCCCCCCCCCCEETTEEEEEEE
T ss_pred             CChHHCEEeEEEecCCCeEEEEEE
Confidence            467899999999999999999986

>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase C, theta type
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.89  E-value=9.8e-07  Score=57.50  Aligned_cols=23  Identities=35%  Similarity=0.543  Sum_probs=21.1

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++||++++.||+|+||+||+|.+
T Consensus         1 iddy~i~~~iG~G~fg~Vy~~~~   23 (320)
T d1xjda_           1 IEDFILHKMLGKGSFGKVFLAEF   23 (320)
T ss_dssp             CTTEEEEEEEEECSSSEEEEEEE
T ss_pred             CCCeEEeeEEecCCCcEEEEEEE
Confidence            58999999999999999999963

>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine-protein kinase Nek2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.87  E-value=8.4e-07  Score=56.51  Aligned_cols=23  Identities=43%  Similarity=0.827  Sum_probs=21.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+||++++.||+|+||+||+|++
T Consensus         3 ~edy~~~~~iG~G~fg~Vy~~~~   25 (269)
T d2java1           3 AEDYEVLYTIGTGSYGRCQKIRR   25 (269)
T ss_dssp             GGGEEEEEEEEECSSEEEEEEEE
T ss_pred             chhCEEeEEEecCCCeEEEEEEE
Confidence            58999999999999999999963

>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: EGF receptor tyrosine kinase, Erbb-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.86  E-value=1.3e-06  Score=56.46  Aligned_cols=23  Identities=39%  Similarity=0.726  Sum_probs=20.9

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +-+||++++.||+|+||+||+|.
T Consensus         7 k~~dy~~~~~lG~G~fG~Vy~~~   29 (317)
T d1xkka_           7 KETEFKKIKVLGSGAFGTVYKGL   29 (317)
T ss_dssp             CTTTEEEEEEEEECSSEEEEEEE
T ss_pred             CHHHCEEeeEEecCCCeEEEEEE
Confidence            45799999999999999999985

>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK2
species: (Plasmodium falciparum) [TaxId: 5833]

Probab=97.83  E-value=1e-06  Score=55.65  Aligned_cols=23  Identities=30%  Similarity=0.596  Sum_probs=20.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||.||+|.+
T Consensus         1 ~~~Y~~~~~iG~G~fg~Vy~~~~   23 (286)
T d1ob3a_           1 MEKYHGLEKIGEGTYGVVYKAQN   23 (286)
T ss_dssp             CCSEEEEEEEEEETTEEEEEEEE
T ss_pred             CCCceeccEEecCCCcEEEEEEe
Confidence            57899999999999999999864

>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase CK2, alpha subunit
species: Rattus norvegicus [TaxId: 10116]

Probab=97.83  E-value=1.1e-06  Score=56.49  Aligned_cols=24  Identities=25%  Similarity=0.642  Sum_probs=21.6

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.++|++++.||+|+||+||+|++
T Consensus        33 ~~d~y~i~~~LG~G~fg~V~~a~~   56 (328)
T d3bqca1          33 NQDDYQLVRKLGRGKYSEVFEAIN   56 (328)
T ss_dssp             CGGGEEEEEEEEECSSEEEEEEEE
T ss_pred             CCcCeEEEEEEecCcCeEEEEEEE
Confidence            457899999999999999999964

>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Dual specificity mitogen-activated protein kinase kinase 1, Mek1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.78  E-value=2e-06  Score=55.71  Aligned_cols=25  Identities=32%  Similarity=0.392  Sum_probs=22.2

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.-+||++++.||+|+||.||+|++
T Consensus         3 l~~d~y~~~~~iG~G~fg~V~~~~~   27 (322)
T d1s9ja_           3 LKDDDFEKISELGAGNGGVVFKVSH   27 (322)
T ss_dssp             CCGGGEEEEEEEECCSSCCEEEEEE
T ss_pred             CCccCCEEEEEEecCCCeEEEEEEE
Confidence            4568999999999999999999963

>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK6
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.77  E-value=1.3e-06  Score=55.38  Aligned_cols=22  Identities=36%  Similarity=0.635  Sum_probs=20.4

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||.||+|++
T Consensus         7 ~~Y~i~~~LG~G~fg~V~~a~~   28 (305)
T d1blxa_           7 QQYECVAEIGEGAYGKVFKARD   28 (305)
T ss_dssp             GTEEEEEEEEEETTEEEEEEEE
T ss_pred             CCEEEEEEEecccCeEEEEEEE
Confidence            6899999999999999999964

>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.76  E-value=2.5e-06  Score=53.76  Aligned_cols=24  Identities=21%  Similarity=0.364  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|++++.||+|+||.||+|.
T Consensus         2 idp~~~~~~~~iG~G~fg~Vy~~~   25 (263)
T d1sm2a_           2 IDPSELTFVQEIGSGQFGLVHLGY   25 (263)
T ss_dssp             BCCSCEEEEEEEECCSSCCEEEEE
T ss_pred             CChHHcEEEEEEeeCCCeEEEEEE
Confidence            456899999999999999999986

>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-jun N-terminal kinase (jnk3s)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.76  E-value=2.3e-06  Score=55.83  Aligned_cols=22  Identities=36%  Similarity=0.501  Sum_probs=18.4

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||+||+|+|
T Consensus        17 ~~Y~i~~~LG~G~fg~V~~~~d   38 (355)
T d2b1pa1          17 KRYQNLKPIGSGAQGIVCAAYD   38 (355)
T ss_dssp             TTEEEEEECSCC--CEEEEEEE
T ss_pred             CCeEEEEEeecCcCeEEEEEEE
Confidence            6799999999999999999974

>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tie2 kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.75  E-value=2.5e-06  Score=54.81  Aligned_cols=26  Identities=35%  Similarity=0.474  Sum_probs=23.4

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++.++|++.+.||+|+||+||+|.
T Consensus         5 ~~i~~~~~~~~~~iG~G~fg~Vy~~~   30 (309)
T d1fvra_           5 PVLDWNDIKFQDVIGEGNFGQVLKAR   30 (309)
T ss_dssp             SBCCGGGCEEEEEEECGGGCEEEEEE
T ss_pred             CccCHHHcEEEEEEeeCCCcEEEEEE
Confidence            45788999999999999999999985

>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.75  E-value=1.5e-06  Score=55.54  Aligned_cols=24  Identities=33%  Similarity=0.702  Sum_probs=21.6

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -++||++++.||+|+||+||+|.+
T Consensus         3 f~~dy~~~~~lG~G~fg~V~~~~~   26 (271)
T d1nvra_           3 FVEDWDLVQTLGEGAYGEVQLAVN   26 (271)
T ss_dssp             TTTEEEEEEEEEEETTEEEEEEEE
T ss_pred             CCcceEEEEEEecCcCeEEEEEEE
Confidence            368999999999999999999963

>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Death-associated protein kinase, Dap
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.73  E-value=2.3e-06  Score=54.57  Aligned_cols=25  Identities=20%  Similarity=0.335  Sum_probs=21.1

Q ss_pred             CCCC-CCCccccccCCccceEeeecC
Q psy17601         40 LGVE-DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~-dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -+++ .|++++.||+|+||+||+|++
T Consensus         6 ~~i~d~Y~~~~~lG~G~fg~Vy~~~~   31 (293)
T d1jksa_           6 ENVDDYYDTGEELGSGQFAVVKKCRE   31 (293)
T ss_dssp             SCGGGTEEEEEEEEECSSEEEEEEEE
T ss_pred             CCcccCEEEeEEEecCCCeEEEEEEE
Confidence            4454 489999999999999999963

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Musk tyrosine kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.72  E-value=3.5e-06  Score=53.88  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|++++.||+|+||+||+|.
T Consensus         9 e~p~~~~~~~~~lG~G~fG~Vy~a~   33 (301)
T d1lufa_           9 EYPRNNIEYVRDIGEGAFGRVFQAR   33 (301)
T ss_dssp             BCCGGGCEEEEEEEECSSCEEEEEE
T ss_pred             cCCHHHcEEeEEEeeCCCeEEEEEE
Confidence            4456899999999999999999985

>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Vascular endothelial growth factor receptor 2 (kdr)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.69  E-value=2.7e-06  Score=54.05  Aligned_cols=24  Identities=29%  Similarity=0.439  Sum_probs=21.6

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++++.||+|+||+||+|.
T Consensus        10 i~~~~y~~~~~iG~G~fG~Vy~a~   33 (299)
T d1ywna1          10 FPRDRLKLGKPLGRGAFGQVIEAD   33 (299)
T ss_dssp             CCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             ccHHHEEEeeEEeecCCeEEEEEE
Confidence            556899999999999999999985

>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fl cytokine receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.69  E-value=2.6e-06  Score=55.16  Aligned_cols=24  Identities=38%  Similarity=0.537  Sum_probs=21.6

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||+||+|.
T Consensus        34 i~~~~~~l~~~lG~G~fG~Vy~a~   57 (325)
T d1rjba_          34 FPRENLEFGKVLGSGAFGKVMNAT   57 (325)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             CCHHHeEEeeEEeeCCCeEEEEEE
Confidence            456899999999999999999985

>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Twitchin, kinase domain
species: Caenorhabditis elegans, pjk4 [TaxId: 6239]

Probab=97.69  E-value=2.1e-06  Score=56.67  Aligned_cols=23  Identities=22%  Similarity=0.572  Sum_probs=20.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||.||+|.+
T Consensus        25 l~~Y~i~~~lG~G~fg~Vy~~~~   47 (350)
T d1koaa2          25 LDHYDIHEELGTGAFGVVHRVTE   47 (350)
T ss_dssp             GGTEEEEEEEEEETTEEEEEEEE
T ss_pred             ccCeEEEEEEecCcCeEEEEEEE
Confidence            57899999999999999999963

>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell division protein kinase 9, CDK9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.68  E-value=2.5e-06  Score=54.48  Aligned_cols=23  Identities=43%  Similarity=0.690  Sum_probs=21.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|++++.||+|+||+||+|++
T Consensus         9 ~~rY~i~~~LG~G~fg~Vy~a~~   31 (318)
T d3blha1           9 VSKYEKLAKIGQGTFGEVFKARH   31 (318)
T ss_dssp             GGGEEEEEEEEECSSSEEEEEEE
T ss_pred             cCCEEEEEEEecCcCeEEEEEEE
Confidence            58899999999999999999974

>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Glycogen synthase kinase-3 beta (Gsk3b)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.67  E-value=1.9e-06  Score=56.14  Aligned_cols=23  Identities=30%  Similarity=0.414  Sum_probs=20.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      --+|..+++||+|+||+||+|++
T Consensus        19 ~~~Y~~~k~LG~G~fg~Vy~a~~   41 (350)
T d1q5ka_          19 EVSYTDTKVIGNGSFGVVYQAKL   41 (350)
T ss_dssp             EEEEEEEEEEEEETTEEEEEEEE
T ss_pred             cCCcEeeeEEeeCcCeEEEEEEE
Confidence            34799999999999999999974

>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase p38
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.65  E-value=3.3e-06  Score=54.36  Aligned_cols=22  Identities=32%  Similarity=0.662  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|++++.||+|+||.||+|+|
T Consensus        18 ~rY~i~~~LG~G~fg~Vy~a~~   39 (348)
T d2gfsa1          18 ERYQNLSPVGSGAYGSVCAAFD   39 (348)
T ss_dssp             TTEEEEEECGGGTTSSEEEEEE
T ss_pred             CCeEEEEEEecCCCeEEEEEEE
Confidence            6799999999999999999974

>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: epha2 receptor tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.63  E-value=5.7e-06  Score=52.51  Aligned_cols=25  Identities=36%  Similarity=0.486  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..+.|...++||+|+||+||+|.
T Consensus         3 ei~~~~~~~~~~iG~G~fG~Vy~~~   27 (283)
T d1mqba_           3 EIHPSCVTRQKVIGAGEFGEVYKGM   27 (283)
T ss_dssp             BCCTTTEEEEEEEEECSSSEEEEEE
T ss_pred             cCCHHHeEeeeEEeeCCCeEEEEEE
Confidence            4667899999999999999999985

>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Abelsone tyrosine kinase (abl)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.62  E-value=4.7e-06  Score=53.25  Aligned_cols=25  Identities=20%  Similarity=0.334  Sum_probs=21.6

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|.+.+.||+|+||+||+|.+
T Consensus        14 i~~~~~~~~~~iG~G~fg~Vy~a~~   38 (287)
T d1opja_          14 MERTDITMKHKLGGGQYGEVYEGVW   38 (287)
T ss_dssp             CCGGGEEEEEETTTTTTSSEEEEEE
T ss_pred             ecHHHeEEeeEEeeCCCeEEEEEEE
Confidence            4567899999999999999999863

>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Activated CDC42 kinase 1, ACK1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.62  E-value=4.1e-06  Score=53.22  Aligned_cols=24  Identities=29%  Similarity=0.605  Sum_probs=17.8

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.+||++++.||+|+||+||+|.
T Consensus         5 i~~~d~~~~~~iG~G~fg~Vy~~~   28 (273)
T d1u46a_           5 IGEKDLRLLEKLGDGSFGVVRRGE   28 (273)
T ss_dssp             CCGGGEEEEEECC----CCCEEEE
T ss_pred             EchHHeEEEEEEecCCCeEEEEEE
Confidence            567899999999999999999985

>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fibroblast growth factor receptor 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.62  E-value=3.9e-06  Score=53.65  Aligned_cols=24  Identities=29%  Similarity=0.344  Sum_probs=16.8

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++++.||+|+||.||+|.
T Consensus        10 i~~~~~~l~~~iG~G~fg~Vy~~~   33 (299)
T d1fgka_          10 LPRDRLVLGKPLGEGAFGQVVLAE   33 (299)
T ss_dssp             CCGGGEEEEEECC-----CEEEEE
T ss_pred             ccHHHeEEeeEEeecCCcEEEEEE
Confidence            456899999999999999999985

>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase p38-gamma
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.61  E-value=4.4e-06  Score=54.04  Aligned_cols=23  Identities=26%  Similarity=0.554  Sum_probs=14.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.|.+++.||+|+||.||+|.|
T Consensus        17 ~~~Y~~i~~lG~G~fg~V~~~~~   39 (346)
T d1cm8a_          17 RAVYRDLQPVGSGAYGAVCSAVD   39 (346)
T ss_dssp             BSSEEEEEEC------CEEEEEE
T ss_pred             CCcEEEEEEEecCCCeEEEEEEE
Confidence            47899999999999999999974

>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.61  E-value=9.7e-06  Score=52.19  Aligned_cols=22  Identities=27%  Similarity=0.545  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||+||+|.+
T Consensus        20 ~~Y~~~~~iG~G~fg~Vy~a~~   41 (293)
T d1yhwa1          20 KKYTRFEKIGQGASGTVYTAMD   41 (293)
T ss_dssp             TTBCSCEECCCSSSCEEEEEEB
T ss_pred             cccEEEEEEecCcCcEEEEEEE
Confidence            4699999999999999999964

>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Mycobacterial protein kinase PknB, catalytic domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=97.61  E-value=4.6e-06  Score=52.56  Aligned_cols=22  Identities=23%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||.||+|.+
T Consensus         7 drY~i~~~lG~G~fg~Vy~a~~   28 (277)
T d1o6ya_           7 DRYELGEILGFGGMSEVHLARD   28 (277)
T ss_dssp             TTEEEEEEEEECSSEEEEEEEE
T ss_pred             ceeEEeEEEeeCCCeEEEEEEE
Confidence            4599999999999999999964

>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Focal adhesion kinase 1 (fak)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.59  E-value=4.6e-06  Score=52.55  Aligned_cols=24  Identities=33%  Similarity=0.566  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||+||+|.
T Consensus         4 i~~~~~~l~~~iG~G~fg~Vy~a~   27 (273)
T d1mp8a_           4 IQRERIELGRCIGEGQFGDVHQGI   27 (273)
T ss_dssp             CCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             cCHHHeEEEEEEeeCCCcEEEEEE
Confidence            445789999999999999999985

>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: gamma-subunit of glycogen phosphorylase kinase (Phk)
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=97.58  E-value=5.1e-06  Score=53.02  Aligned_cols=23  Identities=30%  Similarity=0.625  Sum_probs=20.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|++++.||+|+||+||+|++
T Consensus         2 ~~~y~~~~~iG~G~~g~V~~~~~   24 (277)
T d1phka_           2 YENYEPKEILGRGVSSVVRRCIH   24 (277)
T ss_dssp             TTTEEEEEEEEECSSEEEEEEEE
T ss_pred             cccCEEceEEecCcCeEEEEEEE
Confidence            37899999999999999999963

>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase activated protein kinase 2, mapkap2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.58  E-value=4.9e-06  Score=54.37  Aligned_cols=24  Identities=21%  Similarity=0.428  Sum_probs=20.7

Q ss_pred             CCCCCCccc-cccCCccceEeeecC
Q psy17601         41 GVEDFEPLK-VIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~-~iG~G~fG~V~La~~   64 (64)
                      -+++|+++. +||+|+||.||+|.+
T Consensus         9 i~~~y~i~~~~lG~G~fg~Vy~a~~   33 (335)
T d2ozaa1           9 IIDDYKVTSQVLGLGINGKVLQIFN   33 (335)
T ss_dssp             GGGTEEEEEEEEEECSSCEEEEEEE
T ss_pred             cccCEEEeeEEeeeccCeEEEEEEE
Confidence            368999985 799999999999964

>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Casein kinase-1, CK1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.57  E-value=5.7e-06  Score=52.42  Aligned_cols=22  Identities=27%  Similarity=0.478  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|++++.||+|+||.||+|.+
T Consensus         7 ~rY~l~~~iG~G~fG~Vy~a~~   28 (299)
T d1ckia_           7 NRYRLGRKIGSGSFGDIYLGTD   28 (299)
T ss_dssp             TTEEEEEEEEECSSSEEEEEEE
T ss_pred             CEEEEeEEEeeCCCcEEEEEEE
Confidence            3599999999999999999964

>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Casein kinase-1, CK1
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=97.56  E-value=6.1e-06  Score=52.59  Aligned_cols=22  Identities=23%  Similarity=0.403  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|.+++.||+|+||.||+|++
T Consensus         5 ~~Y~i~~~iG~G~fG~Vy~a~~   26 (293)
T d1csna_           5 VHYKVGRRIGEGSFGVIFEGTN   26 (293)
T ss_dssp             TTEEEEEEEEECSSCEEEEEEE
T ss_pred             CceEEEEEEecCCCeEEEEEEE
Confidence            4699999999999999999964

>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Proto-oncogene serine/threonine-protein kinase Pim-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.55  E-value=4.5e-06  Score=52.75  Aligned_cols=22  Identities=23%  Similarity=0.495  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||+|+||.||+|.+
T Consensus         4 ~~Y~i~~~lG~G~fg~Vy~a~~   25 (273)
T d1xwsa_           4 SQYQVGPLLGSGGFGSVYSGIR   25 (273)
T ss_dssp             TTEEEEEEEEEETTEEEEEEEE
T ss_pred             CeEEEeEEEeeCCCeEEEEEEE
Confidence            5799999999999999999864

>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Titin, kinase domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.55  E-value=6.3e-06  Score=53.47  Aligned_cols=23  Identities=26%  Similarity=0.534  Sum_probs=20.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||+||+|.+
T Consensus         4 ~~rY~i~~~lG~G~fg~Vy~~~~   26 (321)
T d1tkia_           4 YEKYMIAEDLGRGEFGIVHRCVE   26 (321)
T ss_dssp             TTTEEEEEEEEECSSEEEEEEEE
T ss_pred             ccceEEEEEEecCCCeEEEEEEE
Confidence            47799999999999999999964

>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Twitchin, kinase domain
species: California sea hare (Aplysia californica), twk43 [TaxId: 6500]

Probab=97.55  E-value=4.3e-06  Score=55.14  Aligned_cols=23  Identities=26%  Similarity=0.606  Sum_probs=20.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|++++.||+|+||+||+|++
T Consensus        28 ~d~Y~i~~~lG~G~fg~V~~a~~   50 (352)
T d1koba_          28 YDYYDILEELGSGAFGVVHRCVE   50 (352)
T ss_dssp             GGTEEEEEEEEEETTEEEEEEEE
T ss_pred             ccceEEEEEEecCCCeEEEEEEE
Confidence            36799999999999999999964

>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.54  E-value=5.9e-06  Score=53.41  Aligned_cols=22  Identities=32%  Similarity=0.466  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|++++.||+|+||+||+|++
T Consensus         9 d~Y~~~~~lG~G~fg~Vy~~~~   30 (307)
T d1a06a_           9 DIYDFRDVLGTGAFSEVILAED   30 (307)
T ss_dssp             GTEEEEEESBSGGGGGEEEEEE
T ss_pred             cceEEEEEEeeccCeEEEEEEE
Confidence            4599999999999999999963

>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.50  E-value=1.8e-05  Score=50.23  Aligned_cols=24  Identities=25%  Similarity=0.295  Sum_probs=21.6

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||+||+|.
T Consensus         5 i~~~~~~~~~~lG~G~fg~Vy~~~   28 (276)
T d1uwha_           5 IPDGQITVGQRIGSGSFGTVYKGK   28 (276)
T ss_dssp             CCTTCCCCCSEEEECSSCEEEEEE
T ss_pred             cccccEEEEEEEeeCCCcEEEEEE
Confidence            456899999999999999999985

>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Insulin-like growth factor 1 receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.49  E-value=7.8e-06  Score=52.49  Aligned_cols=24  Identities=21%  Similarity=0.444  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||.||+|.
T Consensus        17 i~~~~~~l~~~lG~G~fG~Vy~a~   40 (308)
T d1p4oa_          17 VAREKITMSRELGQGSFGMVYEGV   40 (308)
T ss_dssp             CCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             ecHHHeEEeeEEeeCCCeEEEEEE
Confidence            456899999999999999999875

>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Carboxyl-terminal src kinase (csk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.48  E-value=8.2e-06  Score=51.65  Aligned_cols=24  Identities=29%  Similarity=0.599  Sum_probs=22.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++||++++.||+|+||.||+|.
T Consensus         4 i~~~~~~~~~~lG~G~fg~Vy~~~   27 (262)
T d1byga_           4 LNMKELKLLQTIGKGEFGDVMLGD   27 (262)
T ss_dssp             CCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             cCHHHeEEeEEEecCCCeEEEEEE
Confidence            567899999999999999999986

>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: STE20-like serine/threonine-protein kinase, SLK
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.43  E-value=7.5e-06  Score=52.48  Aligned_cols=25  Identities=32%  Similarity=0.509  Sum_probs=20.9

Q ss_pred             CCC-CCCCccccccCCccceEeeecC
Q psy17601         40 LGV-EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~-~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++. +.|++++.||+|+||+||+|++
T Consensus         8 ~~p~d~Y~i~~~iG~G~fg~Vy~~~~   33 (288)
T d2jfla1           8 LNPEDFWEIIGELGDGAFGKVYKAQN   33 (288)
T ss_dssp             SCGGGTEEEEEEEEEETTEEEEEEEE
T ss_pred             CCcccCeEEeEEEeeCCCcEEEEEEE
Confidence            455 4579999999999999999963

>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase Erk2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.43  E-value=1.2e-05  Score=52.22  Aligned_cols=22  Identities=32%  Similarity=0.555  Sum_probs=16.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|++++.||+|+||+||+|.+
T Consensus         8 ~rY~~~~~LG~G~fg~Vy~~~~   29 (345)
T d1pmea_           8 PRYTNLSYIGEGAYGMVCSAYD   29 (345)
T ss_dssp             TTEEEEEECC---CCCEEEEEE
T ss_pred             CCeEEEEEEeeccCeEEEEEEE
Confidence            4599999999999999999964

>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.42  E-value=1.8e-05  Score=50.69  Aligned_cols=25  Identities=28%  Similarity=0.424  Sum_probs=22.7

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|++.+.||+|+||+||+|.
T Consensus        22 ~i~~~~~~~~~~lG~G~fg~Vy~~~   46 (299)
T d1jpaa_          22 EIDISCVKIEQVIGAGEFGEVCSGH   46 (299)
T ss_dssp             BCCGGGEEEEEEEEECSSSEEEEEE
T ss_pred             hhChhhcEEeeEEeeCCCeEEEEEE
Confidence            5677899999999999999999985

>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.41  E-value=8.2e-06  Score=51.57  Aligned_cols=24  Identities=25%  Similarity=0.389  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||+||+|.
T Consensus        10 i~~~~~~~~~~iG~G~fg~Vy~~~   33 (272)
T d1qpca_          10 VPRETLKLVERLGAGQFGEVWMGY   33 (272)
T ss_dssp             CCGGGEEEEEEEEEETTEEEEEEE
T ss_pred             cCHHHeEEeEEEecCCCcEEEEEE
Confidence            455789999999999999999986

>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine protein kinase TAO2
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.38  E-value=1.3e-05  Score=51.90  Aligned_cols=20  Identities=40%  Similarity=0.655  Sum_probs=18.6

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |+.++.||+|+||+||+|++
T Consensus        17 y~~l~~lG~G~fg~Vy~a~~   36 (309)
T d1u5ra_          17 FSDLREIGHGSFGAVYFARD   36 (309)
T ss_dssp             EEEEEEEEECSSSEEEEEEE
T ss_pred             cEeeEEEecCCCeEEEEEEE
Confidence            99999999999999999963

>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Sky1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.32  E-value=1.7e-05  Score=50.83  Aligned_cols=21  Identities=19%  Similarity=0.297  Sum_probs=19.1

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|.+++.||+|+||.||+|++
T Consensus        14 rY~i~~~LG~G~fg~Vy~~~~   34 (362)
T d1q8ya_          14 RYILVRKLGWGHFSTVWLAKD   34 (362)
T ss_dssp             TEEEEEEEEECSSEEEEEEEE
T ss_pred             cEEEEEEEeeCCCeEEEEEEE
Confidence            399999999999999999964

>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.27  E-value=2e-05  Score=50.43  Aligned_cols=24  Identities=25%  Similarity=0.339  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||+||+|+
T Consensus        14 i~~~~~~i~~~iG~G~fg~Vy~~~   37 (285)
T d1fmka3          14 IPRESLRLEVKLGQGCFGEVWMGT   37 (285)
T ss_dssp             CCGGGEEEEEEEEECSSCEEEEEE
T ss_pred             cCHHHEEEeeEEeeCCCeEEEEEE
Confidence            456889999999999999999986

>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-KIT receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.24  E-value=2.6e-05  Score=49.93  Aligned_cols=24  Identities=25%  Similarity=0.379  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||.||+|.
T Consensus        20 ~~~~~~~l~~~iG~G~fg~Vy~a~   43 (311)
T d1t46a_          20 FPRNRLSFGKTLGAGAFGKVVEAT   43 (311)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEE
T ss_pred             CCHHHeEEeeEEeecCCeEEEEEE
Confidence            455889999999999999999984

>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase ZAP-70
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.79  E-value=0.00012  Score=46.66  Aligned_cols=24  Identities=21%  Similarity=0.483  Sum_probs=19.5

Q ss_pred             CCCCCCCcccc-ccCCccceEeeec
Q psy17601         40 LGVEDFEPLKV-IGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~-iG~G~fG~V~La~   63 (64)
                      +..++|.+..+ ||+|+||.||+|.
T Consensus         5 l~~~~~~~~~~~iG~G~fg~Vy~~~   29 (285)
T d1u59a_           5 LKRDNLLIADIELGCGNFGSVRQGV   29 (285)
T ss_dssp             CCGGGEEEEEEEEECCTTEEEEEEE
T ss_pred             ecccCeEECCcEEecccCeEEEEEE
Confidence            34567777776 9999999999984

>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase wnk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.53  E-value=0.00019  Score=45.34  Aligned_cols=19  Identities=37%  Similarity=0.434  Sum_probs=15.8

Q ss_pred             CccccccCCccceEeeecC
Q psy17601         46 EPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        46 ~~~~~iG~G~fG~V~La~~   64 (64)
                      .....||+|+||+||+|.+
T Consensus        12 ~~~~~iG~G~fg~Vy~~~~   30 (270)
T d1t4ha_          12 KFDIEIGRGSFKTVYKGLD   30 (270)
T ss_dssp             EEEEEEEECSSEEEEEEEE
T ss_pred             EeeeEEecCcCcEEEEEEE
Confidence            4556799999999999864

>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Type I TGF-beta receptor R4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.43  E-value=0.00031  Score=44.75  Aligned_cols=21  Identities=29%  Similarity=0.427  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|-+.+.||+|+||.||+|.
T Consensus         3 ~~~~l~~~iG~G~fg~Vy~~~   23 (303)
T d1vjya_           3 RTIVLQESIGKGRFGEVWRGK   23 (303)
T ss_dssp             GGEEEEEEEECCSSSEEEEEE
T ss_pred             cEEEEEEEEeeCCCeEEEEEE
Confidence            456677889999999999985

>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase SYK
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.04  E-value=0.00062  Score=42.86  Aligned_cols=15  Identities=40%  Similarity=0.691  Sum_probs=13.4

Q ss_pred             ccccCCccceEeeec
Q psy17601         49 KVIGRGAFGECPKKI   63 (64)
Q Consensus        49 ~~iG~G~fG~V~La~   63 (64)
                      +.||+|+||+||+|.
T Consensus        13 k~iG~G~fG~Vy~~~   27 (277)
T d1xbba_          13 KELGSGNFGTVKKGY   27 (277)
T ss_dssp             EEEEECSSEEEEEEE
T ss_pred             CCcccCCCeEEEEEE
Confidence            479999999999984

>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Hepatocyte growth factor receptor, c-MET
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.88  E-value=0.00062  Score=43.57  Aligned_cols=16  Identities=44%  Similarity=0.607  Sum_probs=14.0

Q ss_pred             cccccCCccceEeeec
Q psy17601         48 LKVIGRGAFGECPKKI   63 (64)
Q Consensus        48 ~~~iG~G~fG~V~La~   63 (64)
                      -.+||+|+||+||.|.
T Consensus        32 ~~~iG~G~fg~Vyk~~   47 (311)
T d1r0pa_          32 NEVIGRGHFGCVYHGT   47 (311)
T ss_dssp             EEEEEEETTEEEEEEE
T ss_pred             ceEEeecCCeEEEEEE
Confidence            4579999999999885