Diaphorina citri psyllid: psy17612

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45

MLLFIFFFQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQNWDLALEDLNKLREYIDGGSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLNRPHYLNAIQTMCPHILRYLATAVIINRSKRNALKDLVKVIQQESYTYKDPITEFLEHLYVSFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKIDTLSVRSEALQALIERKVKVRNNSANAGGENSWASKEMLASKADLNVITIMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKIDTLSVRSEALQALIERKVKVRNNSANAGGENSWASKEF

cccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccHHHHccHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEccccEEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHccccccccccccEEEEccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccc

*LLFIFFFQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQNWDLALEDLNKLREYIDGGSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLNRPHYLNAIQTMCPHILRYLATAVIINRSKRNALKDLVKVIQQESYTYKDPITEFLEHLYVSFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKIDTLSVRSEALQALIERKV**************WASKEMLASKADLNVITIMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKIDTLSVRSEALQALIE***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLLFIFFFQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQNWDLALEDLNKLREYIDGGSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLNRPHYLNAIQTMCPHILRYLATAVIINRSKRNALKDLVKVIQQESYTYKDPITEFLEHLYVSFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPxxxxxxxxxxxxxxxxxxxxxIERKVKVRNNSANAGGENSWASKEMLASKADLNVITIMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPxxxxxxxxxxxxxxxxxxxxxIERKVKVRNNSANAGGENSWASKEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Eukaryotic translation initiation factor 3 subunit E	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	very confident	O77410
Eukaryotic translation initiation factor 3 subunit E	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	very confident	Q29EX2
Eukaryotic translation initiation factor 3 subunit E	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	very confident	Q7QIL8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]	nucleus	confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016605 [CC]	PML body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003743 [MF]	translation initiation factor activity	probable	GO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0048812 [BP]	neuron projection morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0006911 [BP]	phagocytosis, engulfment	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008180 [CC]	signalosome	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0048703 [BP]	embryonic viscerocranium morphogenesis	probable	GO:0048705, GO:0048562, GO:0048568, GO:0001501, GO:0048706, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0043009, GO:0048598, GO:0048704, GO:0009887, GO:0032501, GO:0048701, GO:0044767, GO:0008150, GO:0044707, GO:0009790, GO:0048856, GO:0032502, GO:0009792, GO:0048731
GO:0009908 [BP]	flower development	probable	GO:0032502, GO:0048367, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0009791, GO:0003006, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0047485 [MF]	protein N-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0006413 [BP]	translational initiation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0043010 [BP]	camera-type eye development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043473 [BP]	pigmentation	probable	GO:0008150, GO:0044699
GO:0005852 [CC]	eukaryotic translation initiation factor 3 complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006352 [BP]	DNA-dependent transcription, initiation	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048477 [BP]	oogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0009651 [BP]	response to salt stress	probable	GO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0000184 [BP]	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0040007 [BP]	growth	probable	GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TXN, chain A
Confidence level:very confident
Coverage over the Query: 19-239,253-295
View the alignment between query and template
View the model in PyMOL

Template: 4B4T, chain R
Confidence level:confident
Coverage over the Query: 6-239,253-294
View the alignment between query and template
View the model in PyMOL

Template: 3TXN, chain A
Confidence level:confident
Coverage over the Query: 349-399
View the alignment between query and template
View the model in PyMOL