Psyllid ID: psy17612
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 449 | ||||||
| 121543721 | 438 | putative eukaryotic translation initiati | 0.703 | 0.721 | 0.770 | 1e-149 | |
| 193643668 | 438 | PREDICTED: eukaryotic translation initia | 0.694 | 0.712 | 0.785 | 1e-148 | |
| 193678701 | 438 | PREDICTED: eukaryotic translation initia | 0.694 | 0.712 | 0.782 | 1e-147 | |
| 242004658 | 436 | eukaryotic translation initiation factor | 0.699 | 0.720 | 0.747 | 1e-144 | |
| 307184310 | 437 | Probable eukaryotic translation initiati | 0.685 | 0.704 | 0.752 | 1e-143 | |
| 91079354 | 440 | PREDICTED: similar to putative eukaryoti | 0.690 | 0.704 | 0.753 | 1e-143 | |
| 307213129 | 437 | Probable eukaryotic translation initiati | 0.688 | 0.707 | 0.746 | 1e-142 | |
| 332019917 | 445 | Eukaryotic translation initiation factor | 0.690 | 0.696 | 0.747 | 1e-142 | |
| 332373482 | 440 | unknown [Dendroctonus ponderosae] | 0.688 | 0.702 | 0.752 | 1e-142 | |
| 383861164 | 437 | PREDICTED: eukaryotic translation initia | 0.679 | 0.697 | 0.756 | 1e-142 |
| >gi|121543721|gb|ABM55547.1| putative eukaryotic translation initiation factor 3 subunit 6 [Maconellicoccus hirsutus] | Back alignment and taxonomy information |
|---|
Score = 534 bits (1375), Expect = e-149, Method: Compositional matrix adjust.
Identities = 255/331 (77%), Positives = 286/331 (86%), Gaps = 15/331 (4%)
Query: 8 FQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQ 67
F FK++ MESMYKLAK+RYECGNYS TTSYLYFYLLVM SD++YL VLWGKLASEIL+Q
Sbjct: 122 FNFKIENMESMYKLAKYRYECGNYSQTTSYLYFYLLVMSPSDKNYLNVLWGKLASEILIQ 181
Query: 68 NWDLALEDLNKLREYIDGGSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLN 127
NW+ ALED+NKLREYID + F + L LLQQRTWLIHWSLFVFFNH KG+DLIIDMFL
Sbjct: 182 NWETALEDINKLREYIDSNA--FANSLQLLQQRTWLIHWSLFVFFNHAKGKDLIIDMFLY 239
Query: 128 RPHYLNAIQTMCPHILRYLATAVIINRSKRNALKDLVKVIQQESYTYKDPITEFLEHLYV 187
RP+YLNAIQTMCPHILRYLATAVIINR +RNALKDLVKVIQQESYTY+DPITEF+EHLYV
Sbjct: 240 RPNYLNAIQTMCPHILRYLATAVIINRGRRNALKDLVKVIQQESYTYRDPITEFIEHLYV 299
Query: 188 SFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESNVID 247
+FDFE AR+KL+EC V+ NDFFL+ACLDEF+ENARLMIFETFCRIHQCISI
Sbjct: 300 NFDFEGARQKLSECQIVIYNDFFLIACLDEFIENARLMIFETFCRIHQCISI-------- 351
Query: 248 KIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKI 307
MLA KLNM ++EAECWIVNLIRNARLDAKIDSKLGHV+MGTQP SPYQQL+EK+
Sbjct: 352 -----NMLAEKLNMKSEEAECWIVNLIRNARLDAKIDSKLGHVVMGTQPTSPYQQLIEKM 406
Query: 308 DTLSVRSEALQALIERKVKVRNNSANAGGEN 338
D+LSVRSEALQALIERK+K R + + G +
Sbjct: 407 DSLSVRSEALQALIERKIKGRPQNIHWGSHD 437
|
Source: Maconellicoccus hirsutus Species: Maconellicoccus hirsutus Genus: Maconellicoccus Family: Pseudococcidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193643668|ref|XP_001949492.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|193678701|ref|XP_001952525.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242004658|ref|XP_002423197.1| eukaryotic translation initiation factor 3 subunit, putative [Pediculus humanus corporis] gi|212506162|gb|EEB10459.1| eukaryotic translation initiation factor 3 subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307184310|gb|EFN70768.1| Probable eukaryotic translation initiation factor 3 subunit E [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|91079354|ref|XP_969967.1| PREDICTED: similar to putative eukaryotic translation initiation factor 3 subunit 6 [Tribolium castaneum] gi|270003495|gb|EEZ99942.1| hypothetical protein TcasGA2_TC002738 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307213129|gb|EFN88651.1| Probable eukaryotic translation initiation factor 3 subunit E [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332019917|gb|EGI60377.1| Eukaryotic translation initiation factor 3 subunit E [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|332373482|gb|AEE61882.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|383861164|ref|XP_003706056.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 449 | ||||||
| FB|FBgn0025582 | 435 | Int6 "Int6 homologue" [Drosoph | 0.699 | 0.721 | 0.702 | 2e-120 | |
| UNIPROTKB|B5DGH9 | 445 | eif3e "Eukaryotic translation | 0.701 | 0.707 | 0.641 | 1.3e-109 | |
| UNIPROTKB|F1S1G0 | 446 | EIF3E "Eukaryotic translation | 0.694 | 0.699 | 0.645 | 1.6e-109 | |
| UNIPROTKB|Q3T102 | 445 | EIF3E "Eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 | |
| UNIPROTKB|E2R1J6 | 445 | EIF3E "Eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 | |
| UNIPROTKB|P60228 | 445 | EIF3E "Eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 | |
| UNIPROTKB|Q4R6G8 | 445 | EIF3E "Eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 | |
| UNIPROTKB|Q5R8K9 | 445 | EIF3E "Eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 | |
| MGI|MGI:99257 | 445 | Eif3e "eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 | |
| RGD|1311521 | 445 | Eif3e "eukaryotic translation | 0.683 | 0.689 | 0.652 | 2.1e-109 |
| FB|FBgn0025582 Int6 "Int6 homologue" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1185 (422.2 bits), Expect = 2.0e-120, P = 2.0e-120
Identities = 234/333 (70%), Positives = 274/333 (82%)
Query: 8 FQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQ 67
+ FK++ +ES YKLAK+ YECGNY +TSYLYF L+VM +D++YL VLWGKLA+EIL
Sbjct: 119 YNFKVEHLESAYKLAKYLYECGNYQESTSYLYFCLIVMSPNDKNYLNVLWGKLAAEILTL 178
Query: 68 NWDLALEDLNKLREYIDGGSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLN 127
NW+ ALEDL +LR+YID +ANF S + LQQRTWLIHWS+ VFFNH KGRDLII+MFL
Sbjct: 179 NWNTALEDLTRLRDYID--NANF-STIQALQQRTWLIHWSVLVFFNHPKGRDLIIEMFLY 235
Query: 128 RPHYLNAIQTMCPHILRYLATAVIINRSKRNALKDLVKVIQQESYTYKDPITEFLEHLYV 187
+P YLNAIQTMCPHI+RYLATAV+INR++RNALKDL+KVIQQESYTY+DPITEFLE LYV
Sbjct: 236 KPLYLNAIQTMCPHIMRYLATAVVINRTRRNALKDLIKVIQQESYTYRDPITEFLECLYV 295
Query: 188 SFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESNVID 247
+FDFE AR KL EC V+ NDFF+VACL+EFVE+ARLMIFETFCRIHQCI+I
Sbjct: 296 NFDFEGARLKLHECQTVILNDFFIVACLNEFVEDARLMIFETFCRIHQCITIS------- 348
Query: 248 KIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKI 307
MLA KLNM +EAECWIVNLIRNARL+AKIDSKLGHV+MGTQPLSPYQQL+EKI
Sbjct: 349 ------MLADKLNMKPNEAECWIVNLIRNARLNAKIDSKLGHVVMGTQPLSPYQQLVEKI 402
Query: 308 DTLSVRSEALQALIERKVKVRNNSANAGGENSW 340
D+LS+RSE L LIERK K + N +A +SW
Sbjct: 403 DSLSMRSEHLAGLIERKSKQKQNQESA---DSW 432
|
|
| UNIPROTKB|B5DGH9 eif3e "Eukaryotic translation initiation factor 3 subunit E" [Salmo salar (taxid:8030)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1G0 EIF3E "Eukaryotic translation initiation factor 3 subunit E" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T102 EIF3E "Eukaryotic translation initiation factor 3 subunit E" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R1J6 EIF3E "Eukaryotic translation initiation factor 3 subunit E" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P60228 EIF3E "Eukaryotic translation initiation factor 3 subunit E" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R6G8 EIF3E "Eukaryotic translation initiation factor 3 subunit E" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R8K9 EIF3E "Eukaryotic translation initiation factor 3 subunit E" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99257 Eif3e "eukaryotic translation initiation factor 3, subunit E" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1311521 Eif3e "eukaryotic translation initiation factor 3, subunit E" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 449 | |||
| pfam01399 | 100 | pfam01399, PCI, PCI domain | 9e-14 | |
| smart00753 | 88 | smart00753, PAM, PCI/PINT associated module | 1e-08 | |
| smart00088 | 88 | smart00088, PINT, motif in proteasome subunits, In | 1e-08 | |
| pfam01399 | 100 | pfam01399, PCI, PCI domain | 2e-06 | |
| smart00753 | 88 | smart00753, PAM, PCI/PINT associated module | 4e-05 | |
| smart00088 | 88 | smart00088, PINT, motif in proteasome subunits, In | 4e-05 |
| >gnl|CDD|216479 pfam01399, PCI, PCI domain | Back alignment and domain information |
|---|
Score = 66.5 bits (163), Expect = 9e-14
Identities = 28/115 (24%), Positives = 42/115 (36%), Gaps = 15/115 (13%)
Query: 178 ITEFLEHLYVSFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCI 237
+ L Y S D E L + + L D L L++ R + + + I
Sbjct: 1 YRDLLRAFY-SGDLSDFEEILADNEDELL-DDGLAELLEDLRRKIRELNLRRLAKPYSSI 58
Query: 238 SIQKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIM 292
S+ LA L + DE E + LIR+ R+ KID G V+
Sbjct: 59 SLS-------------DLAKLLGLSVDEVEKILSKLIRDGRIRGKIDQVNGIVVF 100
|
This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Length = 100 |
| >gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module | Back alignment and domain information |
|---|
| >gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
| >gnl|CDD|216479 pfam01399, PCI, PCI domain | Back alignment and domain information |
|---|
| >gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module | Back alignment and domain information |
|---|
| >gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 449 | |||
| KOG2758|consensus | 432 | 100.0 | ||
| KOG0687|consensus | 393 | 100.0 | ||
| KOG1464|consensus | 440 | 100.0 | ||
| COG5187 | 412 | RPN7 26S proteasome regulatory complex component, | 100.0 | |
| KOG2758|consensus | 432 | 99.93 | ||
| PF01399 | 105 | PCI: PCI domain; InterPro: IPR000717 A homology do | 99.64 | |
| KOG0686|consensus | 466 | 99.64 | ||
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 99.44 | |
| smart00753 | 88 | PAM PCI/PINT associated module. | 99.43 | |
| smart00088 | 88 | PINT motif in proteasome subunits, Int-6, Nip-1 an | 99.43 | |
| KOG1463|consensus | 411 | 99.12 | ||
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 98.52 | |
| KOG2908|consensus | 380 | 98.39 | ||
| smart00753 | 88 | PAM PCI/PINT associated module. | 98.13 | |
| smart00088 | 88 | PINT motif in proteasome subunits, Int-6, Nip-1 an | 98.13 | |
| KOG1498|consensus | 439 | 97.77 | ||
| PF01399 | 105 | PCI: PCI domain; InterPro: IPR000717 A homology do | 97.76 | |
| KOG1497|consensus | 399 | 97.59 | ||
| KOG2753|consensus | 378 | 97.45 | ||
| COG5071 | 439 | RPN5 26S proteasome regulatory complex component [ | 97.36 | |
| PF10075 | 143 | PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro | 96.84 | |
| KOG2581|consensus | 493 | 96.58 | ||
| KOG2072|consensus | 988 | 96.26 | ||
| KOG1076|consensus | 843 | 96.11 | ||
| KOG2688|consensus | 394 | 94.96 | ||
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 94.09 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 93.9 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 93.18 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 92.4 | |
| KOG2582|consensus | 422 | 92.28 | ||
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 92.02 | |
| PF09756 | 188 | DDRGK: DDRGK domain; InterPro: IPR019153 This is a | 91.92 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 91.79 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 91.5 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 90.97 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 90.9 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 90.59 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 89.41 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 89.32 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 89.06 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 88.79 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 88.72 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 88.3 | |
| KOG0687|consensus | 393 | 87.98 | ||
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 87.34 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 87.08 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 87.08 | |
| PRK15431 | 78 | ferrous iron transport protein FeoC; Provisional | 86.43 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 86.43 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 85.59 | |
| KOG2581|consensus | 493 | 85.36 | ||
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 85.04 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 84.17 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 83.92 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 83.66 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 83.18 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 83.17 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 81.9 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 81.77 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 81.22 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 81.1 | |
| KOG1464|consensus | 440 | 81.04 | ||
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 80.39 |
| >KOG2758|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-109 Score=819.49 Aligned_cols=310 Identities=68% Similarity=1.133 Sum_probs=303.9
Q ss_pred eccCCCHHHHHHHHHHHHHHHhcCChhhHHHHHHHHHhcCCCcchhhHHHHHHHHHHhHhhcChHHHHHHHHHHHHHHhc
Q psy17612 6 FFFQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQNWDLALEDLNKLREYIDG 85 (449)
Q Consensus 6 ~~~~~~~e~~d~lyk~Akf~y~~GdY~~A~~~L~~~~~l~~~~~~k~ls~lwgkla~eIl~~dwd~a~~~l~kLke~id~ 85 (449)
.+|||++|++++|||||||+|+||||+.|+++||+|+.++++.++++++++|||+|+||+++|||.|++++.||||+||+
T Consensus 120 e~ynf~~e~i~~lykyakfqyeCGNY~gAs~yLY~~r~l~~~~d~n~lsalwGKlASEIL~qnWd~A~edL~rLre~IDs 199 (432)
T KOG2758|consen 120 EHYNFTPERIETLYKYAKFQYECGNYSGASDYLYFYRALVSDPDRNYLSALWGKLASEILTQNWDGALEDLTRLREYIDS 199 (432)
T ss_pred HhcCCCHHHHHHHHHHHHHHHhccCcccHHHHHHHHHHhcCCcchhhHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHcc
Confidence 57999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred CCCCCCChHHHHHHHHHHHHHHHHHHhcCccchhhHHHHhcCCchhhhHHHhhhhHHHHHHHHHHHhc-cccccchHHHH
Q psy17612 86 GSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLNRPHYLNAIQTMCPHILRYLATAVIIN-RSKRNALKDLV 164 (449)
Q Consensus 86 ~~~~~~~pl~~l~qR~WliHwsLf~ffn~~~g~~~~iD~F~~~~~yl~aIqt~cp~lLRYlvvA~Il~-~~r~~~l~dlv 164 (449)
+.|.+|..+++|||||+|||||+|||||+|++.++|+|+++|.|+|||||+|||+||||++|+++| ++|++.++|+|
T Consensus 200 --~~f~~~~~~l~qRtWLiHWslfv~fnhpkgrd~iid~fly~p~YLNaIQt~cPhllRYLatAvvtnk~~rr~~lkdlv 277 (432)
T KOG2758|consen 200 --KSFSTSAQQLQQRTWLIHWSLFVFFNHPKGRDTIIDMFLYQPPYLNAIQTSCPHLLRYLATAVVTNKRRRRNRLKDLV 277 (432)
T ss_pred --cccccHHHHHHHHHHHHHHHHHhhccCCChhhHHHHHHccCHHHHHHHHhhCHHHHHHHHHHhhcchHhhHHHHHHHH
Confidence 788999999999999999999999999999999999999999999999999999999999999999 67788999999
Q ss_pred HHHhhhccCCCchHHHHHHHHhhcccHHHHHHHHHHHhhhcccccchHHhHHHHHHHHHHHHHHHhhhhceeeEeecccc
Q psy17612 165 KVIQQESYTYKDPITEFLEHLYVSFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESN 244 (449)
Q Consensus 165 ~vi~qE~~~Y~DpiT~fv~~lYv~fdf~~aq~~L~~~~~vl~~DfFL~~~~d~fvenaR~~ife~ycriy~~IsI~~~~~ 244 (449)
+||+||+|+|+||+|+|++|+|++|||++||++|++|++||.|||||++|.++|+|+||++|||+|||||+||+|
T Consensus 278 kVIqqE~ysYkDPiteFl~clyvn~DFdgAq~kl~eCeeVl~nDfFLva~l~~F~E~ARl~ifEtfCRIHqcIti----- 352 (432)
T KOG2758|consen 278 KVIQQESYSYKDPITEFLECLYVNYDFDGAQKKLRECEEVLVNDFFLVALLDEFLENARLLIFETFCRIHQCITI----- 352 (432)
T ss_pred HHHHHhccccCCcHHHHHHHHhhccchHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHHheeH-----
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccchhhHHhhcCCCHHHHHHHHHHHHHcccccceecccCCEEEeCCCCCChHHHHHHhhhhhhhHHHHHHHHHHHH
Q psy17612 245 VIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPLSPYQQLLEKIDTLSVRSEALQALIERK 324 (449)
Q Consensus 245 ~~~~~~~~~~LA~~Lnms~~e~E~wIVnlIr~~rLdaKIDs~~G~V~m~~~~~s~Yqqviek~d~L~~R~q~L~~~i~~~ 324 (449)
+|||++|||+++|+|+||||+||++||+|||||+.|+|+|++|+.|+|||+|++|+.|++|+|.|+..++++
T Consensus 353 --------~mLA~kLnm~~eeaErwivnlIr~~rl~AkidSklg~Vvmg~~~~s~~qQ~ie~tksLS~rsq~la~~lek~ 424 (432)
T KOG2758|consen 353 --------DMLADKLNMDPEEAERWIVNLIRTARLDAKIDSKLGHVVMGHPTVSPHQQLIEKTKSLSFRSQNLAQQLEKK 424 (432)
T ss_pred --------HHHHHHhcCCHHHHHHHHHHHHHHhhhhhhhccccCceeecCCCCCHHHHHHHhccccchhHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhhcC
Q psy17612 325 VKVRNN 330 (449)
Q Consensus 325 ~~~~~~ 330 (449)
.++.+.
T Consensus 425 ~~~~~~ 430 (432)
T KOG2758|consen 425 IQQKKH 430 (432)
T ss_pred HHHhhc
Confidence 776643
|
|
| >KOG0687|consensus | Back alignment and domain information |
|---|
| >KOG1464|consensus | Back alignment and domain information |
|---|
| >COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2758|consensus | Back alignment and domain information |
|---|
| >PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins | Back alignment and domain information |
|---|
| >KOG0686|consensus | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >smart00753 PAM PCI/PINT associated module | Back alignment and domain information |
|---|
| >smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
| >KOG1463|consensus | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2908|consensus | Back alignment and domain information |
|---|
| >smart00753 PAM PCI/PINT associated module | Back alignment and domain information |
|---|
| >smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
| >KOG1498|consensus | Back alignment and domain information |
|---|
| >PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins | Back alignment and domain information |
|---|
| >KOG1497|consensus | Back alignment and domain information |
|---|
| >KOG2753|consensus | Back alignment and domain information |
|---|
| >COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 | Back alignment and domain information |
|---|
| >KOG2581|consensus | Back alignment and domain information |
|---|
| >KOG2072|consensus | Back alignment and domain information |
|---|
| >KOG1076|consensus | Back alignment and domain information |
|---|
| >KOG2688|consensus | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG2582|consensus | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0687|consensus | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK15431 ferrous iron transport protein FeoC; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG2581|consensus | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1464|consensus | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 449 | |||
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 5e-13 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 7e-04 |
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 | Back alignment and structure |
|---|
Score = 69.5 bits (169), Expect = 5e-13
Identities = 39/304 (12%), Positives = 91/304 (29%), Gaps = 27/304 (8%)
Query: 20 KLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQNWDLALEDLNKL 79
+L ++ Y+ + L + D L V L S+ AL +L K
Sbjct: 104 RLIALYFDTALYTEALALGAQLLRELKKLDDKNLLVEVQLLESKTY-----HALSNLPKA 158
Query: 80 REYIDGGSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFL-NRPHYLNAIQTM 138
R + + + + L S + + F + +
Sbjct: 159 RAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVK 218
Query: 139 CPHILRYLATAVIINRSKRNALKDLVKVIQQESYTYKDPITEFLEHL---YVSFDFESAR 195
L+Y+ I+ + + + V + + TY + ++ + +
Sbjct: 219 ALTSLKYMLLCKIML-GQSDDVN--QLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQ 275
Query: 196 EKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISIQKESNVIDKIFDGQML 255
L E + L D + A L + + + + +
Sbjct: 276 AALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAH-------------V 322
Query: 256 ASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGT--QPLSPYQQLLEKIDTLSVR 313
A + + + E + +I + + +D G +I+ Y+++LE I ++
Sbjct: 323 AESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKV 382
Query: 314 SEAL 317
+ L
Sbjct: 383 VDTL 386
|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 449 | |||
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 100.0 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 99.97 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 99.89 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 99.79 | |
| 4b4t_O | 393 | 26S proteasome regulatory subunit RPN9; hydrolase, | 99.68 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 99.53 | |
| 1ufm_A | 84 | COP9 complex subunit 4; helix-turn-helix, structur | 99.24 | |
| 3t5v_B | 455 | Nuclear mRNA export protein THP1; PCI, mRNA nuclea | 98.98 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 98.72 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.6 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 98.56 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 98.48 | |
| 1ufm_A | 84 | COP9 complex subunit 4; helix-turn-helix, structur | 98.07 | |
| 3chm_A | 169 | COP9 signalosome complex subunit 7; heat/ARM repea | 97.88 | |
| 4b0z_A | 229 | RPN12, 26S proteasome regulatory subunit RPN12; pr | 97.11 | |
| 4b4t_O | 393 | 26S proteasome regulatory subunit RPN9; hydrolase, | 96.52 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 96.38 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 96.12 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.0 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.81 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 95.09 | |
| 1wi9_A | 72 | Protein C20ORF116 homolog; helix-turn-helix motif, | 94.24 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 94.13 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 94.08 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 93.77 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 93.51 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 93.4 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 93.1 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 93.06 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 92.86 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 92.83 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 92.81 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 92.61 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 92.58 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 92.53 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 92.46 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.34 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 92.32 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 92.15 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 92.11 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 92.1 | |
| 3t5v_B | 455 | Nuclear mRNA export protein THP1; PCI, mRNA nuclea | 92.1 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 92.08 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 92.06 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 92.05 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 92.02 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 91.9 | |
| 3chm_A | 169 | COP9 signalosome complex subunit 7; heat/ARM repea | 91.87 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 91.71 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 91.42 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 91.36 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 91.22 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 91.16 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 91.07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 91.07 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 91.05 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 91.0 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 90.94 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 90.93 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 90.87 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 90.77 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 90.62 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 90.61 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 90.53 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 90.43 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 90.41 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 90.39 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 90.29 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 89.93 | |
| 3t5v_A | 316 | Nuclear mRNA export protein SAC3; PCI, mRNA nuclea | 89.84 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 89.83 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 89.76 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 89.61 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 89.47 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 89.39 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 89.38 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 89.35 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 89.31 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 89.26 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 89.25 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 89.2 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 89.18 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 89.14 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 89.12 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 88.94 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 88.89 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 88.74 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 88.54 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 88.53 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 88.41 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 88.41 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 88.15 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 88.12 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 88.04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 88.03 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 88.02 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 87.91 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 87.83 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 87.75 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 87.74 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 87.6 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 87.57 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 87.37 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 87.3 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 86.94 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 86.87 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 86.52 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 86.5 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 86.45 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 86.43 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 86.09 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 86.05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 85.95 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 85.93 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 85.91 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 85.65 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 85.15 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 84.99 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 84.97 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 84.95 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 84.3 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 84.22 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 84.11 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 84.1 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 83.92 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 83.43 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 83.39 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 83.34 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 83.29 | |
| 1rz4_A | 226 | Eukaryotic translation initiation factor 3 subuni; | 82.8 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 82.62 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 82.26 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 82.01 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 81.69 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 81.3 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 80.92 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 80.85 |
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-43 Score=362.26 Aligned_cols=293 Identities=15% Similarity=0.132 Sum_probs=231.8
Q ss_pred eccCCCHHHHHHHHHHHHHHHhcCChhhHHHHHHHHHhcCCCcchhhHHHHHHHHHHhHhhcChHHHHHHHHHHHHHHhc
Q psy17612 6 FFFQFKMDMMESMYKLAKFRYECGNYSITTSYLYFYLLVMPTSDRHYLAVLWGKLASEILVQNWDLALEDLNKLREYIDG 85 (449)
Q Consensus 6 ~~~~~~~e~~d~lyk~Akf~y~~GdY~~A~~~L~~~~~l~~~~~~k~ls~lwgkla~eIl~~dwd~a~~~l~kLke~id~ 85 (449)
.++..+.|++++++++|+||++||||++|.+++..++..|++.+.+ ++.+|+.+++.++.+||..+...++|++.+++.
T Consensus 122 ~~~~~e~e~~~~~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~k-id~~l~~irl~l~~~d~~~~~~~~~ka~~~~~~ 200 (429)
T 4b4t_R 122 EDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAK-IDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEK 200 (429)
T ss_dssp HCCSCCCCCSSCCHHHHHHHHHHCCCTTHHHHHHHHHHHHTCCCSH-HHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHTT
T ss_pred hhccccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCChHHH-HHHHHHHHHHHHHhccHHHHHHHHHHHHHhhhc
Confidence 3466788899999999999999999999999999999999877655 999999999999999999999999999999999
Q ss_pred CCCCCCChHHHHHHHHHHHHHHHHHHhcCccchhhHHHHhcCCchhhhHHHhhhhHHHHHHHHHHHhccccccch-----
Q psy17612 86 GSANFESPLHLLQQRTWLIHWSLFVFFNHVKGRDLIIDMFLNRPHYLNAIQTMCPHILRYLATAVIINRSKRNAL----- 160 (449)
Q Consensus 86 ~~~~~~~pl~~l~qR~WliHwsLf~ffn~~~g~~~~iD~F~~~~~yl~aIqt~cp~lLRYlvvA~Il~~~r~~~l----- 160 (449)
+++| .++..++...|++||+..-|. .|...|+|+|. +|....-.....++.|.+++++++.+|.+..
T Consensus 201 ~~d~--~~~~~lk~~~gl~~l~~r~f~---~Aa~~f~e~~~---t~~~~e~~~~~~~~~y~~l~al~~~~r~~l~~~v~~ 272 (429)
T 4b4t_R 201 GGDW--ERRNRYKTYYGIHCLAVRNFK---EAAKLLVDSLA---TFTSIELTSYESIATYASVTGLFTLERTDLKSKVID 272 (429)
T ss_dssp CCCT--HHHHHHHHHHHHGGGGTSCHH---HHHHHHHHHHH---HSCCSCHHHHHHHHHHHHHHHHHTTCHHHHHHSSSS
T ss_pred CCCH--HHHHHHHHHHHHHHHHhChHH---HHHHHHHHHhc---cCCccchhhHHHHHHHHHHHHHhcCCHHHHHHHHhc
Confidence 7765 345567788899999876665 58999999998 6666655666689999999999998886543
Q ss_pred -HHHHHHHhhhccCCCchHHHHHHHHhhcccHHHHHHHHHHHhhhcccccchHHhHHHHHHHHHHHHHHHhhhhceeeEe
Q psy17612 161 -KDLVKVIQQESYTYKDPITEFLEHLYVSFDFESAREKLTECTEVLDNDFFLVACLDEFVENARLMIFETFCRIHQCISI 239 (449)
Q Consensus 161 -~dlv~vi~qE~~~Y~DpiT~fv~~lYv~fdf~~aq~~L~~~~~vl~~DfFL~~~~d~fvenaR~~ife~ycriy~~IsI 239 (449)
+++..++..++ .-+|+++|+.++|....++-++..+..+...+..|+||++|.++|.+++|..++.+||+||++|+|
T Consensus 273 ~~~~~~~l~~~p--~~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~d~~l~~h~~~l~~~ir~~~l~q~~~~Ys~I~l 350 (429)
T 4b4t_R 273 SPELLSLISTTA--ALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSL 350 (429)
T ss_dssp SHHHHHGGGSHH--HHHHHHHHHHHHHHTCHHHHHHHHHHHHSTTTTTCTTSTTTHHHHHHHHHHHHHHHHHHTCSEEEH
T ss_pred CHHHHhhccCCh--hHHHHHHHHHHHHhccHHHHHHHHHHHHHhhhccCHHHHHHHHHHHHHHHHHHHHHHhHHhceeeH
Confidence 33344443333 346689999999998777777777888899999999999999999999999999999999999999
Q ss_pred eccccccccccchhhHHhhcCCCHHHHHHHHHHHHHcccccceecccCCEEEeCCCC--CChHHHHHHhhhhhhhHHHHH
Q psy17612 240 QKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQP--LSPYQQLLEKIDTLSVRSEAL 317 (449)
Q Consensus 240 ~~~~~~~~~~~~~~~LA~~Lnms~~e~E~wIVnlIr~~rLdaKIDs~~G~V~m~~~~--~s~Yqqviek~d~L~~R~q~L 317 (449)
+.||+.||+|++++|+||++||++|||+||||+++|+|++++|+ ++.||++|++||.|++|+|+|
T Consensus 351 -------------~~mA~~l~~s~~~~E~~L~~lI~~g~l~akID~~~giv~~~~~d~~~~~y~~~i~~gd~Ll~riqkl 417 (429)
T 4b4t_R 351 -------------KSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKY 417 (429)
T ss_dssp -------------HHHHHHHTSCHHHHHHHHHHHHHHTSSCEEEETTTTEEEECC-------------------------
T ss_pred -------------HHHHHHhCcCHHHHHHHHHHHHHcCCeEEEEcCCCCEEEECCCCchhHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999986 589999999999999999999
Q ss_pred HHHHH
Q psy17612 318 QALIE 322 (449)
Q Consensus 318 ~~~i~ 322 (449)
+++|+
T Consensus 418 ~~~i~ 422 (429)
T 4b4t_R 418 GAAVR 422 (429)
T ss_dssp -----
T ss_pred HHHHh
Confidence 99985
|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3t5v_A Nuclear mRNA export protein SAC3; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 449 | ||||
| d1ufma_ | 84 | a.4.5.47 (A:) COP9 signalosome complex subunit 4, | 5e-09 | |
| d1ufma_ | 84 | a.4.5.47 (A:) COP9 signalosome complex subunit 4, | 1e-07 |
| >d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: PCI domain (PINT motif) domain: COP9 signalosome complex subunit 4, GSN4 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 50.5 bits (121), Expect = 5e-09
Identities = 15/81 (18%), Positives = 27/81 (33%), Gaps = 17/81 (20%)
Query: 218 FVENARLMIFETFCRIHQCISIQKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNA 277
+E+ L + + I + L + L + +AE +I
Sbjct: 16 VIEHNLLSASKLYNNIT-----------------FEELGALLEIPAAKAEKIASQMITEG 58
Query: 278 RLDAKIDSKLGHVIMGTQPLS 298
R++ ID G V T+ S
Sbjct: 59 RMNGFIDQIDGIVHFETREAS 79
|
| >d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 449 | |||
| d1ufma_ | 84 | COP9 signalosome complex subunit 4, GSN4 {Mouse (M | 99.21 | |
| d1ufma_ | 84 | COP9 signalosome complex subunit 4, GSN4 {Mouse (M | 98.29 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.07 | |
| d1wi9a_ | 72 | Hypothetical protein C20orf116 homolog {Mouse (Mus | 92.92 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 92.66 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 90.74 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 90.07 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 88.95 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 88.02 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 87.54 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 87.09 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 87.04 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 86.45 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 85.74 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 85.04 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 83.58 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 83.54 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 82.54 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 82.03 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 81.58 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 80.88 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 80.85 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 80.66 |
| >d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: PCI domain (PINT motif) domain: COP9 signalosome complex subunit 4, GSN4 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.21 E-value=1.4e-11 Score=99.58 Aligned_cols=64 Identities=19% Similarity=0.184 Sum_probs=57.1
Q ss_pred HHHHHHHHHhhhhceeeEeeccccccccccchhhHHhhcCCCHHHHHHHHHHHHHcccccceecccCCEEEeCCCCC
Q psy17612 221 NARLMIFETFCRIHQCISIQKESNVIDKIFDGQMLASKLNMGTDEAECWIVNLIRNARLDAKIDSKLGHVIMGTQPL 297 (449)
Q Consensus 221 naR~~ife~ycriy~~IsI~~~~~~~~~~~~~~~LA~~Lnms~~e~E~wIVnlIr~~rLdaKIDs~~G~V~m~~~~~ 297 (449)
+.+-.-+..+-++|.+|+| +.||+.||++++++|.+|+++|.+++|+||||+++|+|++.++..
T Consensus 15 ~i~Ehni~~is~~Y~~Isl-------------~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~ 78 (84)
T d1ufma_ 15 AVIEHNLLSASKLYNNITF-------------EELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA 78 (84)
T ss_dssp HHHHHHHHHHHHSCSEEEH-------------HHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSC
T ss_pred HHHHHHHHHHHHhhceeeH-------------HHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCc
Confidence 3444445578899999999 999999999999999999999999999999999999999988753
|
| >d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|