Diaphorina citri psyllid: psy17615


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MIHSLFIINSTSDIILEKHWKRIISRSVCDYFFEAQNSVAKPEDIPPIITTPHHYLISVYRKGVFFVAVTMSEVPPLFVIEFLDRVVTTFHDYFNDCSESVLKDNYVVVYEILDEMLDNGFPLATESNVLKELIKPPNILRTIANTMTGGSNVSSILPSGQLSSVPWRRTGGSNVSSILPSGQLSSVPWRRTGVKYTNNEAYFDVIEEVDAIIDKTGSTIFSEIQGYIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRFKRWEAERILSFIPPDGNFRLMSYHINTQNLVAIPLYINHNINFKQNKIDMTIGPKQTIGRTIENIVIEIPMPSVVLNCTLLQNQGKYTFDPIKKILTWDLHSTERSGDQGKYTFDPIKKILTWDVGRIDIENKLPNIRGSFTVQSGQENHNFNLTINVKFTINQLAISGLKVNRLDMYGEKYKPFKGVKYITTGGTFQ
cEEEEEEEcccccEEEEEcccccccHHHHHHHHHHHcccccccccccEEEcccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEHEEEcccccEEEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccEEEECcccccEEEEEEEEcccccccccEEEEEEEEECccEEEEEEcccccccccccEEEEEEcccccccccEEEEEccEEEEcccccEEEEEEccccccccccEEECcccccEEEEEEECccccccccccccccccccccccccccccEEEEEEEccEEcccEEEEEEEEEcccccccccEEEEEcccccc
MIHSLFIINSTSDIILEKHWKRIISRSVCDYFFEAQNSVAKPEDIPPIITTPHHYLISVYRKGVFFVAVTMSEVPPLFVIEFLDRVVTTFHDYFNDCSESVLKDNYVVVYEILDEMLDNGFPLATESNVLKELIKPPNILRTIANTMTG**************************************PWRRTGVKYTNNEAYFDVIEEVDAIIDKTGSTIFSEIQGYIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRFKRWEAERILSFIPPDGNFRLMSYHINTQNLVAIPLYINHNINFKQNKIDMTIGPKQTIGRTIENIVIEIPMPSVVLNCTLLQNQGKYTFDPIKKILTWDLHSTERSGDQGKYTFDPIKKILTWDVGRIDIENKLPNIRGSFTVQSGQENHNFNLTINVKFTINQLAISGLKVNRLDMYGEKYKPFKGVKYITTG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIHSLFIINSTSDIILEKHWKRIISRSVCDYFFEAQNSVAKPEDIPPIITTPHHYLISVYRKGVFFVAVTMSEVPPLFVIEFLDRVVTTFHDYFNDCSESVLKDNYVVVYEILDEMLDNGFPLATESNVLKELIKPPNILRTIANTMTGGSNVSSILPSGQLSSVPWRRTGGSNVSSILPSGQLSSVPWRRTGVKYTNNEAYFDVIEEVDAIIDKTGSTIFSEIQGYIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRFKRWEAERILSFIPPDGNFRLMSYHINTQNLVAIPLYINHNINFKQNKIDMTIGPKQTIGRTIENIVIEIPMPSVVLNCTLLQNQGKYTFDPIKKILTWDLHSTERSGDQGKYTFDPIKKILTWDVGRIDIENKLPNIRGSFTVQSGQENHNFNLTINVKFTINQLAISGLKVNRLDMYGEKYKPFKGVKYITTGGTFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP-3 complex subunit mu-1 Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.very confidentP53676
AP-3 complex subunit mu-1 Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.very confidentQ24K11
AP-3 complex subunit mu-1 Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.very confidentQ9JKC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006622 [BP]protein targeting to lysosomeprobableGO:0008104, GO:0072666, GO:0072665, GO:0007041, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072594, GO:0034613, GO:0006623, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0007034, GO:0046907, GO:0033365, GO:0044763, GO:0009987
GO:0048490 [BP]anterograde synaptic vesicle transportprobableGO:0019226, GO:0035637, GO:0051649, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0097480, GO:0097479, GO:0051641, GO:0032501, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763, GO:0009987
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0007220 [BP]Notch receptor processingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016183 [BP]synaptic vesicle coatingprobableGO:0019226, GO:0035637, GO:0051649, GO:0006901, GO:0006900, GO:0061024, GO:0032501, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0016185, GO:0016044, GO:0071840, GO:0016043, GO:0048488, GO:0097479, GO:0051641, GO:0006810, GO:0050877, GO:0009987, GO:0070142, GO:0044765, GO:0044763, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0003008, GO:0006996, GO:0044700, GO:0006897, GO:0016192, GO:0044707, GO:0016050, GO:0051640, GO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008089 [BP]anterograde axon cargo transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0008088, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0044699, GO:0051641
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006727 [BP]ommochrome biosynthetic processprobableGO:0048069, GO:0033060, GO:0048066, GO:0044249, GO:0046152, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0042440, GO:0042441, GO:0044550, GO:0008150, GO:0071704, GO:0043324, GO:0046158, GO:0018130, GO:0032502, GO:0009987, GO:0019748, GO:0006725, GO:0006726, GO:0009058, GO:0008055, GO:0008152, GO:0046148, GO:0046483, GO:0043473, GO:0044699, GO:0043474, GO:0044237, GO:0019438
GO:0030123 [CC]AP-3 adaptor complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0030117, GO:0044424, GO:0044425, GO:0030119, GO:0048475
GO:0030131 [CC]clathrin adaptor complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0030117, GO:0044424, GO:0044425, GO:0030119, GO:0030118, GO:0048475
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 1-153,187-352,378-459
View the alignment between query and template
View the model in PyMOL
Template: 2XA7, chain M
Confidence level:confident
Coverage over the Query: 1-157,181-361
View the alignment between query and template
View the model in PyMOL