Diaphorina citri psyllid: psy17622


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
AKHSNNWAVLVDTSRFWFNYRHVANAKHSNNWAVLVDTSRFWFNYRHVANVLSIYRSVKRLGIPDSHIILMIADDMACNPRNPRPATVFNNANQHIDVYGEDVEVDYRGYEVTVENFIRLLTATSVLTDEGSNILIYLTGHGGDGFLKFQDSEEVTSQELGDALEQMWQKRRYHEVRACNRYREVTVIVTYQRK
ccccccHHHHHHcccccHHHcccccccccccEEEEEEccccccccEEEHHHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEcccccccccccccCECcccccccHHHHHHHHHccEEcccccccEEEEEcccccccCEECcccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcc
****NNWAVLVDTSRFWFNYRHVANAKHSNNWAVLVDTSRFWFNYRHVANVLSIYRSVKRLGIPDSHIILMIADDMACNPRNPRPATVFNNANQHIDVYGEDVEVDYRGYEVTVENFIRLLTATSVLTDEGSNILIYLTGHGGDGFLKFQDSEEVTSQELGDALEQMWQKRRYHEVRACNRYREVTVIVTYQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AKHSNNWAVLVDTSRFWFNYRHVANAKHSNNWAVLVDTSRFWFNYRHVANVLSIYRSVKRLGIPDSHIILMIADDMACNPRNPRPATVFNNANQHIDVYGEDVEVDYRGYEVTVENFIRLLTATSVLTDEGSNILIYLTGHGGDGFLKFQDSEEVTSQELGDALEQMWQKRRYHEVRACNRYREVTVIVTYQRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GPI-anchor transamidase Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein.confidentQ9CXY9
GPI-anchor transamidase Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein.confidentQ92643
GPI-anchor transamidase Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein.confidentQ5R6L8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042765 [CC]GPI-anchor transamidase complexprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0003923 [MF]GPI-anchor transamidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0034394 [BP]protein localization to cell surfaceprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0006501 [BP]C-terminal protein lipidationprobableGO:0018410, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0043687, GO:0009987, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0006497, GO:0044238, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0009059
GO:0003756 [MF]protein disulfide isomerase activityprobableGO:0016853, GO:0003824, GO:0003674, GO:0016864, GO:0016862, GO:0016860
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0050976 [BP]detection of mechanical stimulus involved in sensory perception of touchprobableGO:0009582, GO:0009581, GO:0050975, GO:0050974, GO:0051606, GO:0044707, GO:0009605, GO:0009628, GO:0050982, GO:0050954, GO:0050896, GO:0007600, GO:0009612, GO:0032501, GO:0050906, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0004197 [MF]cysteine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016255 [BP]attachment of GPI anchor to proteinprobableGO:0006650, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044255, GO:0045017, GO:0006629, GO:0044267, GO:0044710, GO:0044260, GO:0008150, GO:0071704, GO:0006505, GO:0006506, GO:0046467, GO:0006664, GO:0006644, GO:0006643, GO:1901576, GO:0009987, GO:0009247, GO:0006464, GO:0043412, GO:0036211, GO:0046488, GO:0008152, GO:0006661, GO:0046486, GO:0090407, GO:0008610, GO:0006497, GO:0044238, GO:0008654, GO:1901137, GO:1901135, GO:0009058, GO:0044237, GO:0043170, GO:0019538, GO:0006796, GO:0009059, GO:0006793, GO:0019637, GO:0046474
GO:0034235 [MF]GPI anchor bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0051861

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F6O, chain A
Confidence level:probable
Coverage over the Query: 28-83,109-166
View the alignment between query and template
View the model in PyMOL