Diaphorina citri psyllid: psy17626


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MFPGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEAY
cccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccCCHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEccccccc
MFPG*MHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEAY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEAY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cryptochrome-1 Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry.confidentQ7PYI7
Cryptochrome-1 Blue light-dependent regulator that is the input of the circadian feedback loop. Has no photolyase activity for cyclobutane pyrimidine dimers or 6-4 photoproducts. Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms. Light induces the degradation of cry, likely due to conformational change in the photoreceptor leading to targeting to the proteasome. Under circadian regulation, expression is influenced by the clock pacemaker genes period, timeless, Clock and cycle. Binding to tim irreversibly commits tim to proteasomal degradation. Functions, together with per, as a transcriptional repressor required for the oscillation of peripheral circadian clocks and for the correct specification of clock cells. Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry. Necessary for light-dependent magnetosensitivity, an intact circadian system is not required for the magnetoreception mechanism to operate. Required for both the naive and trained responses to magnetic field, consistent with the notion that Cry is in the input pathway of magnetic sensing.confidentQ293P8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003914 [MF]DNA (6-4) photolyase activityprobableGO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0005641 [CC]nuclear envelope lumenprobableGO:0005575, GO:0043226, GO:0043231, GO:0031970, GO:0005635, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0005634, GO:0044422
GO:0005488 [MF]bindingprobableGO:0003674
GO:0009416 [BP]response to light stimulusprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FY4, chain A
Confidence level:very confident
Coverage over the Query: 4-122
View the alignment between query and template
View the model in PyMOL
Template: 3FY4, chain A
Confidence level:very confident
Coverage over the Query: 122-184
View the alignment between query and template
View the model in PyMOL