Psyllid ID: psy17626
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 184 | ||||||
| 307611923 | 536 | cryptochrome 1 [Bombyx mori] gi|30641610 | 0.646 | 0.222 | 0.554 | 2e-35 | |
| 62955979 | 548 | antennal cryptochrome [Mamestra brassica | 0.646 | 0.217 | 0.554 | 6e-35 | |
| 148467519 | 348 | antennal cryptochrome 1 [Spodoptera litt | 0.646 | 0.341 | 0.554 | 2e-34 | |
| 404313303 | 528 | cryptochrome 1 [Mythimna separata] | 0.646 | 0.225 | 0.554 | 2e-34 | |
| 324103935 | 548 | cryptochrome [Spodoptera exigua] gi|3241 | 0.646 | 0.217 | 0.554 | 2e-34 | |
| 312371404 | 608 | hypothetical protein AND_22153 [Anophele | 0.711 | 0.215 | 0.526 | 2e-34 | |
| 13022111 | 525 | cryptochrome [Antheraea pernyi] | 0.646 | 0.226 | 0.537 | 2e-34 | |
| 124107288 | 539 | cryptochrome precursor [Dianemobius nigr | 0.646 | 0.220 | 0.554 | 8e-34 | |
| 158301399 | 545 | AGAP001958-PA [Anopheles gambiae str. PE | 0.711 | 0.240 | 0.511 | 1e-33 | |
| 386762983 | 528 | cryptochrome 1 [Agrotis ipsilon] | 0.646 | 0.225 | 0.546 | 1e-33 |
| >gi|307611923|ref|NP_001182628.1| cryptochrome 1 [Bombyx mori] gi|306416108|gb|ADM86932.1| cryptochrome 1 [Bombyx mori] gi|306416112|gb|ADM86934.1| cryptochrome 1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 2e-35, Method: Compositional matrix adjust.
Identities = 66/119 (55%), Positives = 88/119 (73%)
Query: 4 GTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDC 63
GT +GYNR R+LLE L DLD+Q K +GG+L +V+G P ++F++L E KLCFEQDC
Sbjct: 44 GTKVVGYNRMRYLLEALDDLDKQFKKYGGRLLLVKGKPSAVFRRLWEEFGIRKLCFEQDC 103
Query: 64 EALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIG 122
E +W RD+ VK C E +T +E VSHTLW+P+ VI+ NG +PPLTY+M+LHTV+ IG
Sbjct: 104 EPVWRPRDESVKTACREIGVTCREHVSHTLWEPDTVIKANGGIPPLTYQMFLHTVATIG 162
|
Source: Bombyx mori Species: Bombyx mori Genus: Bombyx Family: Bombycidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|62955979|gb|AAY23345.1| antennal cryptochrome [Mamestra brassicae] | Back alignment and taxonomy information |
|---|
| >gi|148467519|gb|ABQ65680.1| antennal cryptochrome 1 [Spodoptera littoralis] | Back alignment and taxonomy information |
|---|
| >gi|404313303|gb|AFR54426.1| cryptochrome 1 [Mythimna separata] | Back alignment and taxonomy information |
|---|
| >gi|324103935|gb|ADY17887.1| cryptochrome [Spodoptera exigua] gi|324103937|gb|ADY17888.1| cryptochrome [Spodoptera exigua] | Back alignment and taxonomy information |
|---|
| >gi|312371404|gb|EFR19605.1| hypothetical protein AND_22153 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|13022111|gb|AAK11644.1|AF333998_1 cryptochrome [Antheraea pernyi] | Back alignment and taxonomy information |
|---|
| >gi|124107288|dbj|BAF45421.1| cryptochrome precursor [Dianemobius nigrofasciatus] | Back alignment and taxonomy information |
|---|
| >gi|158301399|ref|XP_321104.4| AGAP001958-PA [Anopheles gambiae str. PEST] gi|205696380|sp|Q7PYI7.4|CRY1_ANOGA RecName: Full=Cryptochrome-1; Short=agCRY1 gi|78191295|gb|ABB29886.1| cryptochrome 1 [Anopheles gambiae] gi|157012451|gb|EAA01270.4| AGAP001958-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|386762983|gb|AFJ22638.1| cryptochrome 1 [Agrotis ipsilon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 184 | ||||||
| UNIPROTKB|Q17DK5 | 545 | cry "Cryptochrome-1" [Aedes ae | 0.646 | 0.218 | 0.537 | 3.4e-34 | |
| UNIPROTKB|Q7PYI7 | 545 | Cry1 "Cryptochrome-1" [Anophel | 0.646 | 0.218 | 0.554 | 7.7e-34 | |
| FB|FBgn0025680 | 542 | cry "cryptochrome" [Drosophila | 0.646 | 0.219 | 0.508 | 7.1e-32 | |
| UNIPROTKB|Q293P8 | 540 | cry "Cryptochrome-1" [Drosophi | 0.646 | 0.220 | 0.524 | 4.4e-31 | |
| UNIPROTKB|Q16526 | 586 | CRY1 "Cryptochrome-1" [Homo sa | 0.679 | 0.213 | 0.408 | 2.5e-22 | |
| UNIPROTKB|Q8WP19 | 586 | CRY1 "Cryptochrome-1" [Macaca | 0.679 | 0.213 | 0.408 | 2.5e-22 | |
| UNIPROTKB|F1MXB2 | 587 | CRY1 "Uncharacterized protein" | 0.679 | 0.212 | 0.408 | 2.5e-22 | |
| UNIPROTKB|E2RMX4 | 587 | CRY1 "Uncharacterized protein" | 0.679 | 0.212 | 0.408 | 2.5e-22 | |
| RGD|735083 | 588 | Cry1 "cryptochrome 1 (photolya | 0.641 | 0.200 | 0.432 | 2.5e-22 | |
| UNIPROTKB|Q32Q86 | 588 | Cry1 "Cryptochrome-1" [Rattus | 0.641 | 0.200 | 0.432 | 2.5e-22 |
| UNIPROTKB|Q17DK5 cry "Cryptochrome-1" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
Score = 372 (136.0 bits), Expect = 3.4e-34, P = 3.4e-34
Identities = 64/119 (53%), Positives = 88/119 (73%)
Query: 4 GTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDC 63
GT +G+NR +FLLE LADLDRQL+ GGQL++ +G+ +++ ++L ELN KLCFEQDC
Sbjct: 49 GTKLVGFNRMKFLLESLADLDRQLREIGGQLYVFKGNAVNVMRRLFEELNIRKLCFEQDC 108
Query: 64 EALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIG 122
E +W RD ++ C ++ E VSHTLWDP+ +I+TNG +PPLTY+M+LHTV IG
Sbjct: 109 EPIWKARDDAIQNLCRMMDVKCVEKVSHTLWDPQQIIRTNGGIPPLTYQMFLHTVDIIG 167
|
|
| UNIPROTKB|Q7PYI7 Cry1 "Cryptochrome-1" [Anopheles gambiae (taxid:7165)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025680 cry "cryptochrome" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q293P8 cry "Cryptochrome-1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16526 CRY1 "Cryptochrome-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WP19 CRY1 "Cryptochrome-1" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MXB2 CRY1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMX4 CRY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|735083 Cry1 "cryptochrome 1 (photolyase-like)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32Q86 Cry1 "Cryptochrome-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 184 | |||
| pfam00875 | 164 | pfam00875, DNA_photolyase, DNA photolyase | 3e-27 | |
| pfam00875 | 164 | pfam00875, DNA_photolyase, DNA photolyase | 1e-11 | |
| COG0415 | 461 | COG0415, PhrB, Deoxyribodipyrimidine photolyase [D | 1e-09 | |
| TIGR02765 | 429 | TIGR02765, crypto_DASH, cryptochrome, DASH family | 6e-09 | |
| TIGR03556 | 471 | TIGR03556, photolyase_8HDF, deoxyribodipyrimidine | 5e-08 | |
| TIGR02765 | 429 | TIGR02765, crypto_DASH, cryptochrome, DASH family | 2e-05 | |
| TIGR03556 | 471 | TIGR03556, photolyase_8HDF, deoxyribodipyrimidine | 0.001 | |
| COG0415 | 461 | COG0415, PhrB, Deoxyribodipyrimidine photolyase [D | 0.002 |
| >gnl|CDD|216167 pfam00875, DNA_photolyase, DNA photolyase | Back alignment and domain information |
|---|
Score = 100 bits (251), Expect = 3e-27
Identities = 36/118 (30%), Positives = 52/118 (44%), Gaps = 1/118 (0%)
Query: 1 MFPGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFE 60
G+ +G R FLLE LADLD L G +L + +G P + +L +EL + + +
Sbjct: 36 AQLGSHKLGAARRWFLLESLADLDESLAKLGIRLVVRRGDPAEVLPELAKELGASAVYWN 95
Query: 61 QDCEALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTV 118
+D E +RD VK+ E I V F H L P V T P + +
Sbjct: 96 RDYEPYERQRDAAVKEALREAGIEVHSFDDHLLVPPGEV-LTKKGKPYKVFTPFWKAW 152
|
This domain binds a light harvesting cofactor. Length = 164 |
| >gnl|CDD|216167 pfam00875, DNA_photolyase, DNA photolyase | Back alignment and domain information |
|---|
| >gnl|CDD|223492 COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234002 TIGR02765, crypto_DASH, cryptochrome, DASH family | Back alignment and domain information |
|---|
| >gnl|CDD|132595 TIGR03556, photolyase_8HDF, deoxyribodipyrimidine photo-lyase, 8-HDF type | Back alignment and domain information |
|---|
| >gnl|CDD|234002 TIGR02765, crypto_DASH, cryptochrome, DASH family | Back alignment and domain information |
|---|
| >gnl|CDD|132595 TIGR03556, photolyase_8HDF, deoxyribodipyrimidine photo-lyase, 8-HDF type | Back alignment and domain information |
|---|
| >gnl|CDD|223492 COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 184 | |||
| PF00875 | 165 | DNA_photolyase: DNA photolyase from Prosite.; Inte | 99.95 | |
| TIGR02765 | 429 | crypto_DASH cryptochrome, DASH family. Photolyases | 99.89 | |
| TIGR03556 | 471 | photolyase_8HDF deoxyribodipyrimidine photo-lyase, | 99.89 | |
| TIGR02766 | 475 | crypt_chrom_pln cryptochrome, plant family. At lea | 99.88 | |
| COG0415 | 461 | PhrB Deoxyribodipyrimidine photolyase [DNA replica | 99.87 | |
| PRK10674 | 472 | deoxyribodipyrimidine photolyase; Provisional | 99.85 | |
| TIGR00591 | 454 | phr2 photolyase PhrII. All proteins in this family | 99.8 | |
| KOG0133|consensus | 531 | 99.56 | ||
| PF00875 | 165 | DNA_photolyase: DNA photolyase from Prosite.; Inte | 99.26 | |
| TIGR02765 | 429 | crypto_DASH cryptochrome, DASH family. Photolyases | 99.09 | |
| TIGR03556 | 471 | photolyase_8HDF deoxyribodipyrimidine photo-lyase, | 99.06 | |
| TIGR02766 | 475 | crypt_chrom_pln cryptochrome, plant family. At lea | 99.01 | |
| COG0415 | 461 | PhrB Deoxyribodipyrimidine photolyase [DNA replica | 98.98 | |
| PRK10674 | 472 | deoxyribodipyrimidine photolyase; Provisional | 98.96 | |
| TIGR00591 | 454 | phr2 photolyase PhrII. All proteins in this family | 98.88 | |
| KOG0133|consensus | 531 | 98.45 | ||
| PF04244 | 224 | DPRP: Deoxyribodipyrimidine photo-lyase-related pr | 97.41 | |
| COG3046 | 505 | Uncharacterized protein related to deoxyribodipyri | 94.93 | |
| PRK12652 | 357 | putative monovalent cation/H+ antiporter subunit E | 92.17 | |
| PRK09982 | 142 | universal stress protein UspD; Provisional | 91.72 | |
| COG1609 | 333 | PurR Transcriptional regulators [Transcription] | 91.22 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 90.54 | |
| cd06287 | 269 | PBP1_LacI_like_8 Ligand-binding domain of uncharac | 89.32 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 88.97 | |
| PF00532 | 279 | Peripla_BP_1: Periplasmic binding proteins and sug | 88.94 | |
| PRK14719 | 360 | bifunctional RNAse/5-amino-6-(5-phosphoribosylamin | 88.9 | |
| PF10087 | 97 | DUF2325: Uncharacterized protein conserved in bact | 87.63 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 86.77 | |
| PRK15005 | 144 | universal stress protein F; Provisional | 86.21 | |
| PRK15456 | 142 | universal stress protein UspG; Provisional | 86.11 | |
| TIGR01088 | 141 | aroQ 3-dehydroquinate dehydratase, type II. This m | 85.76 | |
| PRK13015 | 146 | 3-dehydroquinate dehydratase; Reviewed | 85.2 | |
| TIGR00289 | 222 | conserved hypothetical protein TIGR00289. Homologo | 85.12 | |
| PF01261 | 213 | AP_endonuc_2: Xylose isomerase-like TIM barrel; In | 83.44 | |
| TIGR00290 | 223 | MJ0570_dom MJ0570-related uncharacterized domain. | 83.09 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 82.49 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 82.48 | |
| KOG1615|consensus | 227 | 81.97 | ||
| PRK11175 | 305 | universal stress protein UspE; Provisional | 81.91 | |
| cd06297 | 269 | PBP1_LacI_like_12 Ligand-binding domain of unchara | 81.54 | |
| PF06415 | 223 | iPGM_N: BPG-independent PGAM N-terminus (iPGM_N); | 81.34 | |
| cd01987 | 124 | USP_OKCHK USP domain is located between the N-term | 81.01 | |
| COG1139 | 459 | Uncharacterized conserved protein containing a fer | 80.44 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 80.29 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 80.28 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 80.08 |
| >PF00875 DNA_photolyase: DNA photolyase from Prosite | Back alignment and domain information |
|---|
Probab=99.95 E-value=1.1e-27 Score=175.53 Aligned_cols=116 Identities=29% Similarity=0.472 Sum_probs=104.3
Q ss_pred CCChhhHHHHHHHHHHHHHHHHhcCCeEEEEECChHHHHHHHHHHcCcceEEEeecccchhHHHHHHHHHHHHhCCCeEE
Q psy17626 7 HIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEALWHKRDKKVKKWCAENNITVK 86 (184)
Q Consensus 7 ~~~~~r~~fl~~sL~~L~~~L~~~g~~L~v~~g~~~~~l~~l~~~~~~~~v~~~~~~~~~~~~rd~~v~~~l~~~gi~~~ 86 (184)
..|++|++|+++||.+|+++|+++|++|+|+.|++.++|++|+++++|++||+|++|++++++||+++++.|++.||.++
T Consensus 42 ~~~~~r~~Fl~~sL~~L~~~L~~~g~~L~v~~g~~~~~l~~l~~~~~~~~V~~~~~~~~~~~~rd~~v~~~l~~~~i~~~ 121 (165)
T PF00875_consen 42 RIGPRRRRFLLESLADLQESLRKLGIPLLVLRGDPEEVLPELAKEYGATAVYFNEEYTPYERRRDERVRKALKKHGIKVH 121 (165)
T ss_dssp SSCHHHHHHHHHHHHHHHHHHHHTTS-EEEEESSHHHHHHHHHHHHTESEEEEE---SHHHHHHHHHHHHHHHHTTSEEE
T ss_pred cCcchHHHHHHHHHHHHHHHHHhcCcceEEEecchHHHHHHHHHhcCcCeeEeccccCHHHHHHHHHHHHHHHhcceEEE
Confidence 46999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EecCceeecccccccccCCCCchhHHHHHHHhhhccc
Q psy17626 87 EFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIGT 123 (184)
Q Consensus 87 ~~~~~~L~~p~~i~~~~~~~~~~v~~~F~~~~~~~~~ 123 (184)
.+++++|++|++++++.+ ++|++||+|++.+.+...
T Consensus 122 ~~~~~~L~~~~~i~~~~~-~~~~vFtpf~k~~~~~~~ 157 (165)
T PF00875_consen 122 TFDDHTLVPPDDIPKKDG-EPYKVFTPFRKKWEKQLL 157 (165)
T ss_dssp EE--SSSS-HHHCHSTTS-SSHSSHHHHHHHHHCHCS
T ss_pred EECCcEEEeccccccCCC-CCcccHHHHHHHHHhcCC
Confidence 999999999999988754 899999999999998765
|
; InterPro: IPR006050 DNA photolyases are enzymes that bind to DNA containing pyrimidine dimers: on absorption of visible light, they catalyse dimer splitting into the constituent monomers, a process called photoreactivation []. This is a DNA repair mechanism, repairing mismatched pyrimidine dimers induced by exposure to ultra-violet light []. The precise mechanisms involved in substrate binding, conversion of light energy to the mechanical energy needed to rupture the cyclobutane ring, and subsequent release of the product are uncertain []. Analysis of DNA lyases has revealed the presence of an intrinsic chromophore, all monomers containing a reduced FAD moiety, and, in addition, either a reduced pterin or 8-hydroxy-5-diazaflavin as a second chromophore [, ]. Either chromophore may act as the primary photon acceptor, peak absorptions occurring in the blue region of the spectrum and in the UV-B region, at a wavelength around 290nm []. This domain binds a light harvesting cofactor.; GO: 0003913 DNA photolyase activity, 0006281 DNA repair; PDB: 3UMV_A 2J07_A 1IQU_A 2J09_A 2J08_A 1IQR_A 1DNP_A 3FY4_B 2VTB_A 2J4D_B .... |
| >TIGR02765 crypto_DASH cryptochrome, DASH family | Back alignment and domain information |
|---|
| >TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type | Back alignment and domain information |
|---|
| >TIGR02766 crypt_chrom_pln cryptochrome, plant family | Back alignment and domain information |
|---|
| >COG0415 PhrB Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10674 deoxyribodipyrimidine photolyase; Provisional | Back alignment and domain information |
|---|
| >TIGR00591 phr2 photolyase PhrII | Back alignment and domain information |
|---|
| >KOG0133|consensus | Back alignment and domain information |
|---|
| >PF00875 DNA_photolyase: DNA photolyase from Prosite | Back alignment and domain information |
|---|
| >TIGR02765 crypto_DASH cryptochrome, DASH family | Back alignment and domain information |
|---|
| >TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type | Back alignment and domain information |
|---|
| >TIGR02766 crypt_chrom_pln cryptochrome, plant family | Back alignment and domain information |
|---|
| >COG0415 PhrB Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10674 deoxyribodipyrimidine photolyase; Provisional | Back alignment and domain information |
|---|
| >TIGR00591 phr2 photolyase PhrII | Back alignment and domain information |
|---|
| >KOG0133|consensus | Back alignment and domain information |
|---|
| >PF04244 DPRP: Deoxyribodipyrimidine photo-lyase-related protein; InterPro: IPR007357 This family appears to be related to DNA photolyases | Back alignment and domain information |
|---|
| >COG3046 Uncharacterized protein related to deoxyribodipyrimidine photolyase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed | Back alignment and domain information |
|---|
| >PRK09982 universal stress protein UspD; Provisional | Back alignment and domain information |
|---|
| >COG1609 PurR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators | Back alignment and domain information |
|---|
| >PRK14719 bifunctional RNAse/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional | Back alignment and domain information |
|---|
| >PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15005 universal stress protein F; Provisional | Back alignment and domain information |
|---|
| >PRK15456 universal stress protein UspG; Provisional | Back alignment and domain information |
|---|
| >TIGR01088 aroQ 3-dehydroquinate dehydratase, type II | Back alignment and domain information |
|---|
| >PRK13015 3-dehydroquinate dehydratase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00289 conserved hypothetical protein TIGR00289 | Back alignment and domain information |
|---|
| >PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 | Back alignment and domain information |
|---|
| >TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >KOG1615|consensus | Back alignment and domain information |
|---|
| >PRK11175 universal stress protein UspE; Provisional | Back alignment and domain information |
|---|
| >cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs | Back alignment and domain information |
|---|
| >PF06415 iPGM_N: BPG-independent PGAM N-terminus (iPGM_N); InterPro: IPR011258 This family represents the N-terminal region of the 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (or phosphoglyceromutase or BPG-independent PGAM) protein (5 | Back alignment and domain information |
|---|
| >cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family | Back alignment and domain information |
|---|
| >COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 184 | ||||
| 4gu5_A | 539 | Structure Of Full-Length Drosophila Cryptochrome Le | 7e-34 | ||
| 4gu5_A | 539 | Structure Of Full-Length Drosophila Cryptochrome Le | 4e-11 | ||
| 3fy4_A | 537 | (6-4) Photolyase Crystal Structure Length = 537 | 3e-20 | ||
| 3fy4_A | 537 | (6-4) Photolyase Crystal Structure Length = 537 | 7e-09 | ||
| 3cvx_A | 543 | Drosophila Melanogaster (6-4) Photolyase H369m Muta | 2e-17 | ||
| 3cvx_A | 543 | Drosophila Melanogaster (6-4) Photolyase H369m Muta | 1e-09 | ||
| 3cvw_A | 543 | Drosophila Melanogaster (6-4) Photolyase H365n Muta | 2e-17 | ||
| 3cvw_A | 543 | Drosophila Melanogaster (6-4) Photolyase H365n Muta | 1e-09 | ||
| 3cvu_A | 543 | Drosophila Melanogaster (6-4) Photolyase Bound To D | 2e-17 | ||
| 3cvu_A | 543 | Drosophila Melanogaster (6-4) Photolyase Bound To D | 1e-09 | ||
| 1owl_A | 484 | Structure Of Apophotolyase From Anacystis Nidulans | 3e-05 | ||
| 1tez_A | 474 | Complex Between Dna And The Dna Photolyase From Ana | 3e-05 |
| >pdb|4GU5|A Chain A, Structure Of Full-Length Drosophila Cryptochrome Length = 539 | Back alignment and structure |
|
| >pdb|4GU5|A Chain A, Structure Of Full-Length Drosophila Cryptochrome Length = 539 | Back alignment and structure |
| >pdb|3FY4|A Chain A, (6-4) Photolyase Crystal Structure Length = 537 | Back alignment and structure |
| >pdb|3FY4|A Chain A, (6-4) Photolyase Crystal Structure Length = 537 | Back alignment and structure |
| >pdb|3CVX|A Chain A, Drosophila Melanogaster (6-4) Photolyase H369m Mutant Bound To Ds Dna With A T-T (6-4) Photolesion Length = 543 | Back alignment and structure |
| >pdb|3CVX|A Chain A, Drosophila Melanogaster (6-4) Photolyase H369m Mutant Bound To Ds Dna With A T-T (6-4) Photolesion Length = 543 | Back alignment and structure |
| >pdb|3CVW|A Chain A, Drosophila Melanogaster (6-4) Photolyase H365n Mutant Bound To Ds Dna With A T-T (6-4) Photolesion And Cofactor F0 Length = 543 | Back alignment and structure |
| >pdb|3CVW|A Chain A, Drosophila Melanogaster (6-4) Photolyase H365n Mutant Bound To Ds Dna With A T-T (6-4) Photolesion And Cofactor F0 Length = 543 | Back alignment and structure |
| >pdb|3CVU|A Chain A, Drosophila Melanogaster (6-4) Photolyase Bound To Ds Dna With A T-T (6-4) Photolesion Length = 543 | Back alignment and structure |
| >pdb|3CVU|A Chain A, Drosophila Melanogaster (6-4) Photolyase Bound To Ds Dna With A T-T (6-4) Photolesion Length = 543 | Back alignment and structure |
| >pdb|1OWL|A Chain A, Structure Of Apophotolyase From Anacystis Nidulans Length = 484 | Back alignment and structure |
| >pdb|1TEZ|A Chain A, Complex Between Dna And The Dna Photolyase From Anacystis Nidulans Length = 474 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 184 | |||
| 3fy4_A | 537 | 6-4 photolyase; DNA repair, clock cryptochrome; HE | 4e-38 | |
| 3fy4_A | 537 | 6-4 photolyase; DNA repair, clock cryptochrome; HE | 2e-17 | |
| 2wq7_A | 543 | RE11660P; lyase-DNA complex, DNA repair, DNA lesio | 1e-37 | |
| 2wq7_A | 543 | RE11660P; lyase-DNA complex, DNA repair, DNA lesio | 2e-17 | |
| 3tvs_A | 538 | Cryptochrome-1; circadian clock light entrainment, | 2e-37 | |
| 3tvs_A | 538 | Cryptochrome-1; circadian clock light entrainment, | 1e-15 | |
| 1np7_A | 489 | DNA photolyase; protein with FAD cofactor; HET: DN | 2e-26 | |
| 1np7_A | 489 | DNA photolyase; protein with FAD cofactor; HET: DN | 4e-13 | |
| 2j4d_A | 525 | Cryptochrome 3, cryptochrome DASH; DNA-binding pro | 4e-25 | |
| 2j4d_A | 525 | Cryptochrome 3, cryptochrome DASH; DNA-binding pro | 7e-14 | |
| 1owl_A | 484 | Photolyase, deoxyribodipyrimidine photolyase; DNA | 5e-18 | |
| 1owl_A | 484 | Photolyase, deoxyribodipyrimidine photolyase; DNA | 1e-07 | |
| 1u3d_A | 509 | Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig | 1e-15 | |
| 1u3d_A | 509 | Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig | 3e-05 | |
| 2e0i_A | 440 | 432AA long hypothetical deoxyribodipyrimidine PHO; | 4e-15 | |
| 2e0i_A | 440 | 432AA long hypothetical deoxyribodipyrimidine PHO; | 1e-06 | |
| 2j07_A | 420 | Deoxyribodipyrimidine photo-lyase; flavoprotein, n | 2e-13 | |
| 2j07_A | 420 | Deoxyribodipyrimidine photo-lyase; flavoprotein, n | 2e-07 | |
| 2xry_A | 482 | Deoxyribodipyrimidine photolyase; DNA damage, DNA | 3e-13 | |
| 2xry_A | 482 | Deoxyribodipyrimidine photolyase; DNA damage, DNA | 3e-06 | |
| 1dnp_A | 471 | DNA photolyase; DNA repair, electron transfer, exc | 2e-12 | |
| 1dnp_A | 471 | DNA photolyase; DNA repair, electron transfer, exc | 6e-05 | |
| 3umv_A | 506 | Deoxyribodipyrimidine photo-lyase; CPD cyclobutane | 9e-11 | |
| 3umv_A | 506 | Deoxyribodipyrimidine photo-lyase; CPD cyclobutane | 1e-04 |
| >3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Length = 537 | Back alignment and structure |
|---|
Score = 135 bits (343), Expect = 4e-38
Identities = 45/117 (38%), Positives = 65/117 (55%)
Query: 3 PGTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQD 62
PG+ G NR RFLLE L DLD LK G +L + +G P + + +E +LCFE D
Sbjct: 53 PGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYD 112
Query: 63 CEALWHKRDKKVKKWCAENNITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVS 119
+ + D KVK + + + V VSHTL++P +I+ NG PPL+Y+ +L
Sbjct: 113 TDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAG 169
|
| >3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Length = 537 | Back alignment and structure |
|---|
| >2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Length = 543 | Back alignment and structure |
|---|
| >2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Length = 543 | Back alignment and structure |
|---|
| >1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Length = 489 | Back alignment and structure |
|---|
| >1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Length = 489 | Back alignment and structure |
|---|
| >2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Length = 525 | Back alignment and structure |
|---|
| >2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Length = 525 | Back alignment and structure |
|---|
| >1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Length = 484 | Back alignment and structure |
|---|
| >1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Length = 484 | Back alignment and structure |
|---|
| >1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Length = 509 | Back alignment and structure |
|---|
| >1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Length = 509 | Back alignment and structure |
|---|
| >2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Length = 440 | Back alignment and structure |
|---|
| >2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Length = 440 | Back alignment and structure |
|---|
| >2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Length = 420 | Back alignment and structure |
|---|
| >2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Length = 420 | Back alignment and structure |
|---|
| >2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Length = 482 | Back alignment and structure |
|---|
| >2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Length = 482 | Back alignment and structure |
|---|
| >1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 Length = 471 | Back alignment and structure |
|---|
| >1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 Length = 471 | Back alignment and structure |
|---|
| >3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Length = 506 | Back alignment and structure |
|---|
| >3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Length = 506 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 184 | |||
| 3fy4_A | 537 | 6-4 photolyase; DNA repair, clock cryptochrome; HE | 99.92 | |
| 3tvs_A | 538 | Cryptochrome-1; circadian clock light entrainment, | 99.91 | |
| 1owl_A | 484 | Photolyase, deoxyribodipyrimidine photolyase; DNA | 99.89 | |
| 1np7_A | 489 | DNA photolyase; protein with FAD cofactor; HET: DN | 99.88 | |
| 2j4d_A | 525 | Cryptochrome 3, cryptochrome DASH; DNA-binding pro | 99.87 | |
| 2wq7_A | 543 | RE11660P; lyase-DNA complex, DNA repair, DNA lesio | 99.87 | |
| 1u3d_A | 509 | Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig | 99.85 | |
| 1dnp_A | 471 | DNA photolyase; DNA repair, electron transfer, exc | 99.85 | |
| 2e0i_A | 440 | 432AA long hypothetical deoxyribodipyrimidine PHO; | 99.83 | |
| 2j07_A | 420 | Deoxyribodipyrimidine photo-lyase; flavoprotein, n | 99.81 | |
| 3umv_A | 506 | Deoxyribodipyrimidine photo-lyase; CPD cyclobutane | 99.78 | |
| 2xry_A | 482 | Deoxyribodipyrimidine photolyase; DNA damage, DNA | 99.74 | |
| 3zxs_A | 522 | Cryptochrome B, rscryb; lyase, cryPro, lumazine, i | 99.26 | |
| 3tvs_A | 538 | Cryptochrome-1; circadian clock light entrainment, | 99.13 | |
| 3fy4_A | 537 | 6-4 photolyase; DNA repair, clock cryptochrome; HE | 99.1 | |
| 1owl_A | 484 | Photolyase, deoxyribodipyrimidine photolyase; DNA | 99.02 | |
| 2wq7_A | 543 | RE11660P; lyase-DNA complex, DNA repair, DNA lesio | 98.96 | |
| 1dnp_A | 471 | DNA photolyase; DNA repair, electron transfer, exc | 98.95 | |
| 1np7_A | 489 | DNA photolyase; protein with FAD cofactor; HET: DN | 98.94 | |
| 2j4d_A | 525 | Cryptochrome 3, cryptochrome DASH; DNA-binding pro | 98.88 | |
| 2e0i_A | 440 | 432AA long hypothetical deoxyribodipyrimidine PHO; | 98.87 | |
| 2j07_A | 420 | Deoxyribodipyrimidine photo-lyase; flavoprotein, n | 98.84 | |
| 1u3d_A | 509 | Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig | 98.82 | |
| 2xry_A | 482 | Deoxyribodipyrimidine photolyase; DNA damage, DNA | 98.75 | |
| 3umv_A | 506 | Deoxyribodipyrimidine photo-lyase; CPD cyclobutane | 98.74 | |
| 3zxs_A | 522 | Cryptochrome B, rscryb; lyase, cryPro, lumazine, i | 97.19 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 93.81 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 93.7 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 93.47 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 92.58 | |
| 1jmv_A | 141 | USPA, universal stress protein A; chaperone; 1.85A | 90.98 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 90.41 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 89.97 | |
| 3s3t_A | 146 | Nucleotide-binding protein, universal stress PROT | 89.73 | |
| 1tq8_A | 163 | Hypothetical protein RV1636; MTCY01B2.28, structur | 89.64 | |
| 4fe7_A | 412 | Xylose operon regulatory protein; HTH_ARAC, helix- | 89.63 | |
| 3gv0_A | 288 | Transcriptional regulator, LACI family; transcript | 89.16 | |
| 1mjh_A | 162 | Protein (ATP-binding domain of protein MJ0577); hy | 88.91 | |
| 3e61_A | 277 | Putative transcriptional repressor of ribose OPER; | 88.66 | |
| 3fdx_A | 143 | Putative filament protein / universal stress PROT; | 88.1 | |
| 3hgm_A | 147 | Universal stress protein TEAD; rossman fold, signa | 87.62 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 87.57 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 87.48 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 87.19 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 86.8 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 86.16 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 86.1 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 85.54 | |
| 2gm3_A | 175 | Unknown protein; AT3G01520, putative ethylene-resp | 85.39 | |
| 3fg9_A | 156 | Protein of universal stress protein USPA family; A | 84.92 | |
| 2dum_A | 170 | Hypothetical protein PH0823; conserved hypothetica | 84.34 | |
| 3vni_A | 294 | Xylose isomerase domain protein TIM barrel; D-psic | 83.65 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 83.15 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 82.73 | |
| 3jvd_A | 333 | Transcriptional regulators; structural genomics, P | 82.57 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 82.48 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 82.34 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 82.05 | |
| 3tnj_A | 150 | Universal stress protein (USP); structural genomic | 82.01 | |
| 3idf_A | 138 | USP-like protein; universal, stress, PSI, MCSG, st | 81.97 | |
| 3bbl_A | 287 | Regulatory protein of LACI family; protein structu | 81.89 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 81.69 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 81.02 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 80.26 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 80.11 |
| >3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=99.92 E-value=3.4e-25 Score=187.16 Aligned_cols=119 Identities=37% Similarity=0.679 Sum_probs=112.9
Q ss_pred CCCCCChhhHHHHHHHHHHHHHHHHhcCCeEEEEECChHHHHHHHHHHcCcceEEEeecccchhHHHHHHHHHHHHhCCC
Q psy17626 4 GTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQGSPISIFQKLKRELNFTKLCFEQDCEALWHKRDKKVKKWCAENNI 83 (184)
Q Consensus 4 ~~~~~~~~r~~fl~~sL~~L~~~L~~~g~~L~v~~g~~~~~l~~l~~~~~~~~v~~~~~~~~~~~~rd~~v~~~l~~~gi 83 (184)
|....|++|++||++||.+|+++|+++|++|+|++|++.++|++|+++++|++||+|++|+|++++||+.|+++|++.||
T Consensus 54 g~~~~g~~r~~Fl~~sL~~L~~~L~~~G~~L~v~~G~~~~vl~~L~~~~~~~~V~~n~~~~p~~~~RD~~v~~~l~~~gI 133 (537)
T 3fy4_A 54 GSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQALDVKVKDYASSTGV 133 (537)
T ss_dssp BCSSCBHHHHHHHHHHHHHHHHHHHHTTCCCEEEESCHHHHHHHHHTTSCEEEEEECCCCSHHHHHHHHHHHHHHHHTTC
T ss_pred ccccCCHHHHHHHHHHHHHHHHHHHHcCCceEEEECCHHHHHHHHHHHcCCCEEEEeccccHHHHHHHHHHHHHHHHcCC
Confidence 45678999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eEEEecCceeecccccccccCCCCchhHHHHHHHhhhcc
Q psy17626 84 TVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIG 122 (184)
Q Consensus 84 ~~~~~~~~~L~~p~~i~~~~~~~~~~v~~~F~~~~~~~~ 122 (184)
+++.+++++|++|+++.+++++++|.+||+|++.+.+..
T Consensus 134 ~~~~~~~~~L~~p~~v~~~~~~~~y~vftpf~k~~~~~~ 172 (537)
T 3fy4_A 134 EVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPS 172 (537)
T ss_dssp EEECCCCSSSSCHHHHHHHTSSSCCSSHHHHHHHHCCCT
T ss_pred eEEEecCCEEEchhhcccCCCCCCCCccCHHHHHHHhhc
Confidence 999999999999999987666679999999999987753
|
| >1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* | Back alignment and structure |
|---|
| >1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 | Back alignment and structure |
|---|
| >2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* | Back alignment and structure |
|---|
| >2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* | Back alignment and structure |
|---|
| >1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* | Back alignment and structure |
|---|
| >1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 | Back alignment and structure |
|---|
| >2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* | Back alignment and structure |
|---|
| >3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* | Back alignment and structure |
|---|
| >3zxs_A Cryptochrome B, rscryb; lyase, cryPro, lumazine, iron-sulfur-cluster; HET: FAD DLZ; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* | Back alignment and structure |
|---|
| >2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* | Back alignment and structure |
|---|
| >1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 | Back alignment and structure |
|---|
| >1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 | Back alignment and structure |
|---|
| >2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* | Back alignment and structure |
|---|
| >2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* | Back alignment and structure |
|---|
| >1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* | Back alignment and structure |
|---|
| >2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* | Back alignment and structure |
|---|
| >3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3zxs_A Cryptochrome B, rscryb; lyase, cryPro, lumazine, iron-sulfur-cluster; HET: FAD DLZ; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A | Back alignment and structure |
|---|
| >3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* | Back alignment and structure |
|---|
| >3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* | Back alignment and structure |
|---|
| >3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 184 | |||
| d1u3da2 | 185 | Cryptochrome {Thale cress (Arabidopsis thaliana) [ | 99.96 | |
| d1np7a2 | 204 | Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: | 99.95 | |
| d1owla2 | 202 | DNA photolyase {Synechococcus elongatus [TaxId: 32 | 99.95 | |
| d1dnpa2 | 200 | DNA photolyase {Escherichia coli [TaxId: 562]} | 99.93 | |
| d2j07a2 | 170 | DNA photolyase {Thermus thermophilus [TaxId: 274]} | 99.92 | |
| d1owla2 | 202 | DNA photolyase {Synechococcus elongatus [TaxId: 32 | 99.33 | |
| d2j07a2 | 170 | DNA photolyase {Thermus thermophilus [TaxId: 274]} | 99.31 | |
| d1u3da2 | 185 | Cryptochrome {Thale cress (Arabidopsis thaliana) [ | 99.3 | |
| d1np7a2 | 204 | Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: | 99.29 | |
| d1dnpa2 | 200 | DNA photolyase {Escherichia coli [TaxId: 562]} | 99.19 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 92.34 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 90.96 | |
| d1mjha_ | 160 | "Hypothetical" protein MJ0577 {Archaeon Methanococ | 88.77 | |
| d1mjha_ | 160 | "Hypothetical" protein MJ0577 {Archaeon Methanococ | 87.93 | |
| d2gm3a1 | 171 | Putative ethylene-responsive protein AT3g01520/F4P | 85.18 | |
| d1ykga1 | 146 | Sulfite reductase alpha-component CysJ N-terminal | 84.93 | |
| d1q77a_ | 138 | Hypothetical protein Aq_178 {Aquifex aeolicus [Tax | 84.04 | |
| d2z3va1 | 135 | Hypothetical protein TTHA0895 {Thermus thermophilu | 83.73 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 83.44 | |
| d2c4va1 | 158 | Type II 3-dehydroquinate dehydratase {Helicobacter | 80.3 |
| >d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Cryptochrome/photolyase, N-terminal domain superfamily: Cryptochrome/photolyase, N-terminal domain family: Cryptochrome/photolyase, N-terminal domain domain: Cryptochrome species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.96 E-value=4.5e-28 Score=177.90 Aligned_cols=118 Identities=21% Similarity=0.319 Sum_probs=111.3
Q ss_pred CCCCCChhhHHHHHHHHHHHHHHHHhcCCeEEEEE-CChHHHHHHHHHHcCcceEEEeecccchhHHHHHHHHHHHHhCC
Q psy17626 4 GTMHIGYNRFRFLLECLADLDRQLKSHGGQLFIVQ-GSPISIFQKLKRELNFTKLCFEQDCEALWHKRDKKVKKWCAENN 82 (184)
Q Consensus 4 ~~~~~~~~r~~fl~~sL~~L~~~L~~~g~~L~v~~-g~~~~~l~~l~~~~~~~~v~~~~~~~~~~~~rd~~v~~~l~~~g 82 (184)
+..+.|++|.+|+++||.+|+++|+++|++|+++. |++.++|.+|+++++|++||+|++|++++++||++|+++|++.|
T Consensus 39 ~~~~~~~~~~~fl~~sL~~L~~~L~~~g~~L~v~~~g~~~~~l~~l~~~~~i~~v~~n~~~~~~e~~rd~~v~~~l~~~g 118 (185)
T d1u3da2 39 GHYHPGRVSRWWLKNSLAQLDSSLRSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQG 118 (185)
T ss_dssp TTCCCCHHHHHHHHHHHHHHHHHHHHTTCCEEEEECSCHHHHHHHHHHHHTCCEEEEECCCSHHHHHHHHHHHHHHHTTT
T ss_pred cccChHHHHHHHHHHHHHHHHHHHHhcCCcceEeeccchHHHHHHHHHhcCCceEEEeccccHHHHHHHHHHHHHHHHcC
Confidence 45678999999999999999999999999999986 89999999999999999999999999999999999999999999
Q ss_pred CeEEEecCceeecccccccccCCCCchhHHHHHHHhhhcc
Q psy17626 83 ITVKEFVSHTLWDPEVVIQTNGNVPPLTYKMYLHTVSCIG 122 (184)
Q Consensus 83 i~~~~~~~~~L~~p~~i~~~~~~~~~~v~~~F~~~~~~~~ 122 (184)
|.++.+++++|++|+++++++| ++|+|||+|++.+.+..
T Consensus 119 i~~~~~~~~~L~~p~~i~~~~g-~~y~vFTpF~k~~~~~~ 157 (185)
T d1u3da2 119 IAVRSFNADLLYEPWEVTDELG-RPFSMFAAFWERCLSMP 157 (185)
T ss_dssp CEEEEECCSCSSCGGGCCCSSS-CCCSSHHHHHHHHHTCS
T ss_pred CceeecCCceecCccccccCCC-CCCcccHHHHHHHHhCc
Confidence 9999999999999999998765 79999999999987753
|
| >d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4va1 c.23.13.1 (A:1-158) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|