Diaphorina citri psyllid: psy17638

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160

MYLSPPLWLTLNLEALVPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDPTTTSAKLAGLEPSTKYRIHLAGYTKAGDGADYFIEHRTRGTDNVAPGKPNFKLVRSGTENGYGAFKVIWEPNPERPGSHFFVKY

cccccccCEEEEccccccccccCEEEEEccccEEEEEcccccccccEEEEEEEEEEECccccccccCECccccccccccEEEEcccccccEEEEEEEEEccccccccccEEEEECcccccccccccEEEEEccccccccEEEEEECccccccccEEEEEc

**LSPPLWLTLNLEALVPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDPTTTSAKLAGLEPSTKYRIHLAGYTKAGDGADYFIEHRTRGTDNVAPGKPNFKLVRSGTENGYGAFKVIWEPNPERPG**F*VKY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYLSPPLWLTLNLEALVPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDPTTTSAKLAGLEPSTKYRIHLAGYTKAGDGADYFIEHRTRGTDNVAPGKPNFKLVRSGTENGYGAFKVIWEPNPERPGSHFFVKY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0031175 [BP]	neuron projection development	probable	GO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0016337 [BP]	cell-cell adhesion	probable	GO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0044304 [CC]	main axon	probable	GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0005911 [CC]	cell-cell junction	probable	GO:0005575, GO:0030054
GO:0005887 [CC]	integral to plasma membrane	probable	GO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V5Y, chain A
Confidence level:very confident
Coverage over the Query: 2-124
View the alignment between query and template
View the model in PyMOL