Psyllid ID: psy17638
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| 242019922 | 1253 | Neuroglian precursor, putative [Pediculu | 0.95 | 0.121 | 0.607 | 1e-47 | |
| 157118545 | 1182 | cell adhesion molecule [Aedes aegypti] g | 0.975 | 0.131 | 0.541 | 3e-41 | |
| 321459544 | 1246 | hypothetical protein DAPPUDRAFT_309386 [ | 0.893 | 0.114 | 0.576 | 1e-39 | |
| 170044415 | 1218 | cell adhesion molecule [Culex quinquefas | 0.95 | 0.124 | 0.535 | 1e-39 | |
| 340714433 | 1251 | PREDICTED: LOW QUALITY PROTEIN: neurogli | 0.981 | 0.125 | 0.534 | 2e-39 | |
| 350399166 | 1247 | PREDICTED: neuroglian-like isoform 2 [Bo | 0.981 | 0.125 | 0.527 | 3e-39 | |
| 350399162 | 1251 | PREDICTED: neuroglian-like isoform 1 [Bo | 0.981 | 0.125 | 0.527 | 3e-39 | |
| 383863731 | 1251 | PREDICTED: neuroglian-like [Megachile ro | 0.981 | 0.125 | 0.534 | 3e-38 | |
| 328788305 | 1251 | PREDICTED: neuroglian [Apis mellifera] | 0.962 | 0.123 | 0.522 | 2e-36 | |
| 380025831 | 1251 | PREDICTED: LOW QUALITY PROTEIN: neurogli | 0.962 | 0.123 | 0.515 | 4e-36 |
| >gi|242019922|ref|XP_002430407.1| Neuroglian precursor, putative [Pediculus humanus corporis] gi|212515537|gb|EEB17669.1| Neuroglian precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 194 bits (492), Expect = 1e-47, Method: Compositional matrix adjust.
Identities = 93/153 (60%), Positives = 115/153 (75%), Gaps = 1/153 (0%)
Query: 9 LTLNLEALVPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLE 68
L+ + VPGTV + EA P+GSSA +L W KPEQPNG++ GYK++YQ+VKGTKVGPL+E
Sbjct: 903 LSFDTPEGVPGTVSAFEAFPMGSSALFLVWKKPEQPNGIITGYKVQYQTVKGTKVGPLVE 962
Query: 69 RLPYISDPTTTSAKLAGLEPSTKYRIHLAGYTKAGDGADYFIEHRTRGTDNVAPGKPNFK 128
R P+I+DP+ T AKLAGLEP+TKYRIH+ G T+AG+G +YFIE RTRG+ P P F
Sbjct: 963 REPFITDPSQTRAKLAGLEPNTKYRIHIRGLTRAGEGEEYFIEQRTRGSHASPPDVPKFV 1022
Query: 129 LVRSGTENGYGAFKVIWEPNPE-RPGSHFFVKY 160
R +ENG KVIW PN E +PGSHFFVKY
Sbjct: 1023 WQRLPSENGLATVKVIWLPNIEGKPGSHFFVKY 1055
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157118545|ref|XP_001659157.1| cell adhesion molecule [Aedes aegypti] gi|108875668|gb|EAT39893.1| AAEL008340-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|321459544|gb|EFX70596.1| hypothetical protein DAPPUDRAFT_309386 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|170044415|ref|XP_001849844.1| cell adhesion molecule [Culex quinquefasciatus] gi|167867576|gb|EDS30959.1| cell adhesion molecule [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|340714433|ref|XP_003395733.1| PREDICTED: LOW QUALITY PROTEIN: neuroglian-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350399166|ref|XP_003485439.1| PREDICTED: neuroglian-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|350399162|ref|XP_003485438.1| PREDICTED: neuroglian-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383863731|ref|XP_003707333.1| PREDICTED: neuroglian-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328788305|ref|XP_395296.3| PREDICTED: neuroglian [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380025831|ref|XP_003696667.1| PREDICTED: LOW QUALITY PROTEIN: neuroglian-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 160 | ||||||
| FB|FBgn0264975 | 1302 | Nrg "Neuroglian" [Drosophila m | 0.9 | 0.110 | 0.472 | 3.1e-30 | |
| ZFIN|ZDB-GENE-990415-10 | 1273 | nadl1.2 "neural adhesion molec | 0.825 | 0.103 | 0.284 | 8e-09 | |
| WB|WBGene00002243 | 1187 | lad-2 [Caenorhabditis elegans | 0.8 | 0.107 | 0.308 | 1.2e-08 | |
| UNIPROTKB|G5ECX2 | 1187 | lad-2 "Immunoglobulin domain-c | 0.8 | 0.107 | 0.308 | 1.2e-08 | |
| FB|FBgn0000464 | 2029 | Lar "Leukocyte-antigen-related | 0.593 | 0.046 | 0.35 | 1.4e-08 | |
| RGD|620911 | 1240 | Nfasc "neurofascin" [Rattus no | 0.412 | 0.053 | 0.352 | 4.2e-08 | |
| MGI|MGI:104753 | 1240 | Nfasc "neurofascin" [Mus muscu | 0.412 | 0.053 | 0.352 | 6.8e-08 | |
| UNIPROTKB|F8W792 | 1268 | NFASC "Neurofascin" [Homo sapi | 0.743 | 0.093 | 0.296 | 7.3e-08 | |
| UNIPROTKB|H7C0L6 | 298 | NFASC "Neurofascin" [Homo sapi | 0.412 | 0.221 | 0.366 | 7.5e-08 | |
| UNIPROTKB|F1LNF4 | 1378 | Ptprf "Receptor-type tyrosine- | 0.818 | 0.095 | 0.270 | 8e-08 |
| FB|FBgn0264975 Nrg "Neuroglian" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 347 (127.2 bits), Expect = 3.1e-30, P = 3.1e-30
Identities = 69/146 (47%), Positives = 94/146 (64%)
Query: 17 VPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDP 76
VP VQ L+A PLGSSAF L W KP PNG L GYKI Y+ VK + VG E P+I+DP
Sbjct: 916 VPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDP 975
Query: 77 TTTSAKLAGLEPSTKYRIHLAGYTKAGDGADYFIEHRT-RGTDNVAPGKPNFKLVRSGTE 135
T K+AGL+P++KYRI + TK G+G++++IE T + NVAP P+F + ++
Sbjct: 976 RVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWEQLPSD 1035
Query: 136 NGYGAFKVIWEPNPE-RPGSHFFVKY 160
NG F++ W P+ E PG+HFF +
Sbjct: 1036 NGLAKFRINWLPSTEGHPGTHFFTMH 1061
|
|
| ZFIN|ZDB-GENE-990415-10 nadl1.2 "neural adhesion molecule L1.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00002243 lad-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5ECX2 lad-2 "Immunoglobulin domain-containing protein Y54G2A.25" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000464 Lar "Leukocyte-antigen-related-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|620911 Nfasc "neurofascin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104753 Nfasc "neurofascin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W792 NFASC "Neurofascin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C0L6 NFASC "Neurofascin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LNF4 Ptprf "Receptor-type tyrosine-protein phosphatase F" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 2e-11 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 1e-09 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 2e-09 | |
| COG3401 | 343 | COG3401, COG3401, Fibronectin type 3 domain-contai | 2e-04 |
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
Score = 57.1 bits (138), Expect = 2e-11
Identities = 20/89 (22%), Positives = 34/89 (38%), Gaps = 5/89 (5%)
Query: 18 PGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDPT 77
P +L + S++ L W PE G + GY ++Y+ + +
Sbjct: 1 PSPPTNLRVTDVTSTSVTLSWTPPEDDGGPITGYVVEYREKGSGDWKEVEVT-----PGS 55
Query: 78 TTSAKLAGLEPSTKYRIHLAGYTKAGDGA 106
TS L GL+P T+Y + G+
Sbjct: 56 ETSYTLTGLKPGTEYEFRVRAVNGGGESP 84
|
Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93 |
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|225936 COG3401, COG3401, Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| KOG4221|consensus | 1381 | 99.82 | ||
| KOG4221|consensus | 1381 | 99.73 | ||
| KOG3513|consensus | 1051 | 99.7 | ||
| KOG3513|consensus | 1051 | 99.61 | ||
| KOG0196|consensus | 996 | 99.57 | ||
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.52 | |
| KOG0196|consensus | 996 | 99.42 | ||
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.98 | |
| KOG4258|consensus | 1025 | 98.81 | ||
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 98.7 | |
| KOG4258|consensus | 1025 | 98.54 | ||
| KOG4222|consensus | 1281 | 98.53 | ||
| KOG4802|consensus | 516 | 98.35 | ||
| KOG4222|consensus | 1281 | 98.22 | ||
| KOG4152|consensus | 830 | 97.68 | ||
| KOG4802|consensus | 516 | 97.68 | ||
| KOG4367|consensus | 699 | 97.19 | ||
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 96.65 | |
| KOG3632|consensus | 1335 | 96.63 | ||
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 95.77 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 95.28 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 95.03 | |
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 94.15 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 93.12 | |
| KOG4152|consensus | 830 | 90.82 | ||
| PLN02533 | 427 | probable purple acid phosphatase | 89.29 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 88.04 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 87.74 | |
| KOG4367|consensus | 699 | 84.79 | ||
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 83.0 | |
| PF11344 | 80 | DUF3146: Protein of unknown function (DUF3146); In | 82.81 | |
| KOG3632|consensus | 1335 | 80.17 |
| >KOG4221|consensus | Back alignment and domain information |
|---|
Probab=99.82 E-value=6e-19 Score=133.55 Aligned_cols=150 Identities=25% Similarity=0.422 Sum_probs=116.5
Q ss_pred CCCCCcc-eEEEcCCCCCCCCCe-eEEEecCCcEEEEEecCCCC--CCCceeeEEEEEEEeCCcccCCceeeceeeeCCc
Q psy17638 2 YLSPPLW-LTLNLEALVPGTVQS-LEAIPLGSSAFYLKWVKPEQ--PNGVLMGYKIKYQSVKGTKVGPLLERLPYISDPT 77 (160)
Q Consensus 2 g~g~~s~-~~~~t~~~~P~~p~~-~~~~~~~~~~~~l~W~~p~~--~~g~i~~y~i~~~~~~~~~~~~~~~~~~~~~~~~ 77 (160)
|.|..|. +.|+|.++.|++|++ +++.....+++.|.|.+|.. .+|.+.+|+|+|......... +..+...+
T Consensus 598 G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~~-----~~t~v~~n 672 (1381)
T KOG4221|consen 598 GSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDEV-----NETVVKGN 672 (1381)
T ss_pred CCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCccccc-----ceeecccc
Confidence 7888998 999999999976665 88888999999999999853 488999999999876433221 12244557
Q ss_pred ccEEEEcCCCCCCEEEEEEEEEeCCCCCCcc-eeEEeecCCCC--CCCCCCccceeeecccCccCeEEEEEecCCC--CC
Q psy17638 78 TTSAKLAGLEPSTKYRIHLAGYTKAGDGADY-FIEHRTRGTDN--VAPGKPNFKLVRSGTENGYGAFKVIWEPNPE--RP 152 (160)
Q Consensus 78 ~~~~~i~~l~p~~~y~~~v~a~~~~g~g~~~-~~~~~t~~~~~--~~p~~p~~~~~~~~~~~~~~~~~l~W~~p~~--~~ 152 (160)
...+++.+|+|++.|.|+|.|.+..|.|+++ +....|..... .+|.+|.. +.+....++|.|+|.||.+ ..
T Consensus 673 ~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~ps~----l~~~~g~~si~vsW~Pp~~~~~~ 748 (1381)
T KOG4221|consen 673 TTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGKPSE----LHVHPGSNSIVVSWTPPPHPNIV 748 (1381)
T ss_pred hhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccCCCCCce----eeeccCceeEEEEeCCCCChhhh
Confidence 7889999999999999999999999999998 56666654432 23444432 4444578999999999985 34
Q ss_pred CceeEEeC
Q psy17638 153 GSHFFVKY 160 (160)
Q Consensus 153 ~~~y~v~y 160 (160)
+.+|.|-|
T Consensus 749 vrgY~ig~ 756 (1381)
T KOG4221|consen 749 VRGYKIGY 756 (1381)
T ss_pred hcceEEee
Confidence 56888876
|
|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >PF11344 DUF3146: Protein of unknown function (DUF3146); InterPro: IPR021492 This family of proteins with unknown function appear to be restricted to Cyanobacteria | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 160 | ||||
| 1x5l_A | 111 | Solution Structure Of The Second Fn3 Domain Of Eph | 1e-05 | ||
| 2djs_A | 108 | Solution Structures Of The Fn3 Domain Of Human Ephr | 2e-05 | ||
| 2edx_A | 134 | Solution Structures Of The Fn3 Domain Of Human Rece | 2e-04 | ||
| 2dlh_A | 121 | Solution Structure Of The Second Fn3 Domain Of Huma | 4e-04 | ||
| 1wfn_A | 119 | The Fourth Fn3 Domain Of Human Sidekick-2 Length = | 8e-04 |
| >pdb|1X5L|A Chain A, Solution Structure Of The Second Fn3 Domain Of Eph Receptor A8 Protein Length = 111 | Back alignment and structure |
|
| >pdb|2DJS|A Chain A, Solution Structures Of The Fn3 Domain Of Human Ephrin Type- B Receptor 1 Length = 108 | Back alignment and structure |
| >pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 | Back alignment and structure |
| >pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 | Back alignment and structure |
| >pdb|1WFN|A Chain A, The Fourth Fn3 Domain Of Human Sidekick-2 Length = 119 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 160 | |||
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 2e-23 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 6e-13 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 6e-23 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 5e-21 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 3e-19 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-18 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 2e-18 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 2e-18 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 6e-18 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 3e-17 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 7e-17 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-16 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 7e-16 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 1e-15 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 1e-15 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 1e-09 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 1e-15 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 4e-15 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 4e-15 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-15 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 7e-15 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 7e-15 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 2e-09 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 6e-09 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 1e-06 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 8e-15 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 3e-09 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 4e-05 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 1e-14 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 4e-10 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 4e-07 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 1e-04 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 3e-14 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-14 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 1e-13 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 7e-08 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-07 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 5e-06 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 1e-13 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-13 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 2e-13 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 5e-13 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 7e-13 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 8e-13 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 1e-09 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 1e-12 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 2e-12 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 5e-12 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 8e-12 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 1e-11 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 2e-10 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 8e-10 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 1e-11 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 3e-11 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 4e-10 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 8e-07 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 2e-11 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 7e-10 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 5e-08 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 2e-05 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 2e-11 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 3e-11 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 9e-10 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 9e-09 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 3e-11 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 6e-11 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 3e-10 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 8e-11 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 7e-10 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 1e-10 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 2e-10 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 5e-10 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-10 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 2e-10 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 3e-09 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 3e-09 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 5e-09 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 5e-09 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 1e-06 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 6e-09 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 7e-09 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 8e-09 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 1e-08 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 1e-08 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 2e-08 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 2e-08 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 8e-08 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 3e-08 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 3e-08 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 4e-08 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 5e-08 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 5e-08 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 6e-08 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 3e-07 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 6e-08 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-08 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 6e-08 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 1e-07 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 1e-07 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 2e-07 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 1e-04 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 4e-07 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 5e-07 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 7e-07 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 8e-07 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 2e-06 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 1e-06 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 2e-06 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 3e-06 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 4e-06 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 6e-06 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 7e-06 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 1e-05 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 2e-05 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 2e-05 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 2e-05 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 1e-04 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 1e-04 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 1e-04 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 4e-04 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 4e-04 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 5e-04 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 8e-04 |
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
Score = 91.0 bits (226), Expect = 2e-23
Identities = 27/134 (20%), Positives = 48/134 (35%), Gaps = 3/134 (2%)
Query: 17 VPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDP 76
VP L + S+ L W +P + NG + Y++ Y V + + +P
Sbjct: 98 VPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNRPIGPMKKVLVDNP 157
Query: 77 TTTSAKLAGLEPSTKYRIHLAGYTKAGDG--ADYFIEHRTR-GTDNVAPGKPNFKLVRSG 133
+ L S YR + AG G + I T+ P P+ +V +
Sbjct: 158 KNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIPDIPIVDAQ 217
Query: 134 TENGYGAFKVIWEP 147
+ Y +F + +
Sbjct: 218 SGEDYDSFLMYSDD 231
|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.86 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.86 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.85 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.84 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.84 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.84 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.84 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.84 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.83 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.83 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.83 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.82 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.82 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.82 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.82 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.82 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.82 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.81 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.81 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.81 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.8 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.8 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.8 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.8 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.8 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.8 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.8 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.8 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.79 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.79 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.79 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.78 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.78 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.78 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.77 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.77 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.76 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.76 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.76 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.76 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.76 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.76 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.75 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.75 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.75 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.75 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.75 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.74 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.74 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.74 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.73 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.72 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.72 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.71 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.71 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.71 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.71 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 99.71 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 99.7 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.7 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.7 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.69 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.69 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.69 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.68 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.68 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.68 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.68 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.68 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.68 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.67 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.67 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.66 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.66 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.66 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 99.66 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.66 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.65 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.65 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.65 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.65 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.65 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.64 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.64 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.64 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.64 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.63 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.63 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.62 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.62 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.62 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.61 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.61 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.61 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.6 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.6 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.59 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.58 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.58 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 99.57 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.57 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.57 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.56 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.56 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.55 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.55 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.55 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.54 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.54 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.54 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.53 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.52 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.51 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.51 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.51 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.51 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.48 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.48 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.48 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.47 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.47 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.47 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.46 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.43 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 99.43 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.43 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.43 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.42 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.42 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.39 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.39 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.39 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.39 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 99.37 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.37 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.37 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.35 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.34 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.33 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.3 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.26 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.21 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.18 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.13 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.13 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 99.12 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.11 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.1 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 99.09 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 99.09 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.08 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 99.06 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.04 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.04 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 98.98 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 98.91 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 98.89 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 98.87 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 98.84 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 98.84 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 98.84 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 98.81 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 98.8 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 98.76 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.74 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 98.65 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 98.64 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 98.63 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.51 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 98.44 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 98.44 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 98.43 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 98.4 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 98.31 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 98.28 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.15 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 97.97 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 97.94 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 97.89 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 97.86 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 97.83 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 97.78 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 97.77 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 97.76 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 97.74 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 97.68 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 97.63 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 97.62 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 97.6 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 97.57 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 97.55 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 97.55 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 97.52 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 97.5 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 97.49 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 97.49 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 97.49 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 97.48 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 97.47 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 97.47 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 97.45 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 97.44 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 97.44 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 97.43 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 97.42 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 97.42 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 97.36 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 97.36 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 97.33 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 97.33 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 97.32 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 97.31 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 97.31 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 97.29 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 97.29 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 97.28 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 97.26 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 97.26 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 97.25 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 97.24 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 97.23 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 97.21 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 97.21 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 97.21 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 97.21 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 97.19 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 97.16 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 97.12 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 97.12 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 97.06 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 97.03 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 97.03 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 97.01 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 97.0 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 97.0 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 97.0 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 96.98 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 96.97 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 96.97 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 96.96 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 96.94 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 96.93 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 96.9 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 96.76 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 96.75 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 96.73 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 96.71 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 96.7 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 96.7 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 96.67 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 96.65 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 96.64 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 96.57 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 96.53 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 96.47 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 96.44 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 96.43 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 96.41 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 96.32 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 96.11 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 96.05 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 95.97 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 95.96 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 95.75 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 95.66 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 95.63 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 95.46 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 95.12 | |
| 4go6_A | 45 | HCF N-terminal chain 1; tandem fibronectin repeat, | 95.08 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 94.62 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 94.54 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 94.08 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 93.82 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 93.11 | |
| 3s9d_B | 199 | Interferon alpha/beta receptor 2; human, type I in | 92.94 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 91.74 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 90.3 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 90.24 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 89.36 | |
| 3ott_A | 758 | Two-component system sensor histidine kinase; beta | 88.63 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 87.42 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 86.93 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 85.54 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 83.8 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 83.6 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 81.46 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 80.95 |
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
Probab=99.86 E-value=9.2e-21 Score=113.68 Aligned_cols=111 Identities=25% Similarity=0.362 Sum_probs=90.6
Q ss_pred CCCCCCcc-eEEEcCCC------CCCCCCeeEEEecCCcEEEEEecCCCCCCCceeeEEEEEEEeCCcccCCceeeceee
Q psy17638 1 MYLSPPLW-LTLNLEAL------VPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYI 73 (160)
Q Consensus 1 ~g~g~~s~-~~~~t~~~------~P~~p~~~~~~~~~~~~~~l~W~~p~~~~g~i~~y~i~~~~~~~~~~~~~~~~~~~~ 73 (160)
.|.|+.|. +.++|.++ +|.+|.++++...+ +++.|.|++|...+|.|.+|.|.|... .... . ...
T Consensus 4 ~G~g~~S~~~~~~T~~~~~~~~~~P~~P~~l~~~~~~-~sv~l~W~~P~~~~g~i~~Y~v~y~~~-~~~~---~---~~~ 75 (126)
T 1x5i_A 4 GSSGPATDWLSAETFESDLDETRVPEVPSSLHVRPLV-TSIVVSWTPPENQNIVVRGYAIGYGIG-SPHA---Q---TIK 75 (126)
T ss_dssp CCCCCCCCCCCSCCCCTTSBCSSCCCSCSEEEEEEET-TEEEEEEECCSCTTBCCCEEEEEECSS-CGGG---E---EEE
T ss_pred CccCCCCCCEEeECccccCccCCCCCCCCeeEEEecC-CEEEEEEcCCCCCCCCEeEEEEEEEcC-CCCc---e---EEE
Confidence 58999998 99999998 99999999998887 999999999987788999999999732 2111 1 123
Q ss_pred eCCcccEEEEcCCCCCCEEEEEEEEEeCCCCCCcceeEEeecCCCC
Q psy17638 74 SDPTTTSAKLAGLEPSTKYRIHLAGYTKAGDGADYFIEHRTRGTDN 119 (160)
Q Consensus 74 ~~~~~~~~~i~~l~p~~~y~~~v~a~~~~g~g~~~~~~~~t~~~~~ 119 (160)
...+.+.++|.+|.|++.|.|+|+|+|..|.|.++.....|..+..
T Consensus 76 ~~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~s~~~~~T~~~~~ 121 (126)
T 1x5i_A 76 VDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTS 121 (126)
T ss_dssp CCTTCCEEEECSCCSSCEECCEEEEECSSCBCCCCCCCEECCCCTT
T ss_pred eCCCeeEEEEeCCCCCCEEEEEEEEEeCCccCcceeeEEecccCCC
Confidence 3566788999999999999999999999999988865666655543
|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 160 | ||||
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 3e-11 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 7e-11 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 4e-10 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 1e-08 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 9e-08 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-07 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 4e-07 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 5e-07 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 8e-07 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-06 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 6e-06 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 7e-06 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 7e-06 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 7e-06 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 8e-06 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 1e-05 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 1e-05 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 2e-05 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 3e-05 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 3e-05 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 4e-05 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-04 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 3e-04 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 3e-04 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 4e-04 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 4e-04 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 0.001 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 0.001 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 0.001 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 0.001 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 0.002 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.002 |
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Ephrin type-A receptor 8 species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.8 bits (131), Expect = 3e-11
Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)
Query: 17 VPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDP 76
P V + G ++ L W +PEQPNG+++ Y+IKY +
Sbjct: 3 APSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKE------MQSYSTLKA 56
Query: 77 TTTSAKLAGLEPSTKYRIHLAGYTKAGDG 105
TT A ++GL+P T+Y + T AG G
Sbjct: 57 VTTRATVSGLKPGTRYVFQVRARTSAGCG 85
|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 160 | |||
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.78 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.76 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.76 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.76 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.75 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.75 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.74 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.72 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.72 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.71 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.71 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.7 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.7 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.69 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.69 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.68 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.67 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.67 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.66 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.66 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.65 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.65 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.65 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.65 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.64 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.63 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.63 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.63 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.62 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.62 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.61 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.61 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.61 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.6 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.6 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.6 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.6 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.59 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.58 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.57 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.57 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.57 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.56 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.56 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.56 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.55 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.55 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.54 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.54 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.52 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.5 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.49 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.48 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.48 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.46 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.46 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.45 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.43 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.41 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.41 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.41 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.31 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 99.3 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.29 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.26 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.23 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 99.2 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.09 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.97 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 98.89 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.31 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.05 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 97.89 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 97.83 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 97.8 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 97.74 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 97.7 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 97.69 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 97.68 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 97.63 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 97.61 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 97.55 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 97.55 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 97.51 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 97.5 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 97.49 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 97.47 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 97.44 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 97.44 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 97.43 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.42 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 97.38 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.31 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 97.3 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.3 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.25 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.25 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 97.25 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.23 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 97.22 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.19 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 97.18 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.17 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 97.16 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 97.15 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.15 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.15 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 97.14 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.11 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.09 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.09 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 97.05 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 97.05 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 97.03 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 97.02 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 97.02 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 97.01 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 96.97 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 96.93 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 96.92 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 96.89 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.86 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 96.85 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 96.8 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 96.77 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 96.74 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 96.72 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.49 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 96.44 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 96.4 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 96.39 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 96.38 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 96.33 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 96.3 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.22 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 96.13 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 95.9 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 95.86 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 95.85 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 95.76 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 95.64 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 95.5 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 95.32 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 95.22 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 95.12 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 95.1 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 94.85 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 94.82 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 94.51 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 94.47 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 94.16 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 94.01 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 94.0 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 93.78 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 93.42 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 92.23 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 90.74 | |
| d1axib1 | 99 | Growth hormone receptor {Human (Homo sapiens) [Tax | 85.24 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 85.1 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 84.17 |
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Sidekick 2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=1.7e-21 Score=113.99 Aligned_cols=105 Identities=20% Similarity=0.293 Sum_probs=87.9
Q ss_pred CCCCCCc-c-eEEEcCCCCCCCCCeeEEEecCCcEEEEEecCCCCCCCceeeEEEEEEEeCCcccCCceeeceeeeCCcc
Q psy17638 1 MYLSPPL-W-LTLNLEALVPGTVQSLEAIPLGSSAFYLKWVKPEQPNGVLMGYKIKYQSVKGTKVGPLLERLPYISDPTT 78 (160)
Q Consensus 1 ~g~g~~s-~-~~~~t~~~~P~~p~~~~~~~~~~~~~~l~W~~p~~~~g~i~~y~i~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (160)
+|.|++| . +.++|.+++|++|.++.+...+.+++.|.|.+|...+|.|.+|.|.|+.......... ........
T Consensus 2 ~G~G~pss~~v~~~T~~~~P~~P~~~~~~~~~~~sv~v~W~~P~~~~g~i~~Y~i~y~~~~~~~~~~~----~~~~~~~~ 77 (117)
T d1wfoa1 2 IGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTANTAT----VEVLAPSA 77 (117)
T ss_dssp CCCCCCCCCCSCCCCSCCCCCCCCCCEEEEECSSEEEEECCCCSCCCSCCCEEEEEEEESSCCCSCCC----EEEECTTC
T ss_pred ccCCCCCCCCEEEECCCCCCcCCCCcEEEEecCCEEEEEEECCCCCCCceEEEeeeeeeccCCCceEe----EEecCCce
Confidence 5899777 4 9999999999999999999899999999999998778899999999987644332211 12445667
Q ss_pred cEEEEcCCCCCCEEEEEEEEEeCCCCCCcce
Q psy17638 79 TSAKLAGLEPSTKYRIHLAGYTKAGDGADYF 109 (160)
Q Consensus 79 ~~~~i~~l~p~~~y~~~v~a~~~~g~g~~~~ 109 (160)
..+++.+|.|++.|.|+|+|.|..|.|+++.
T Consensus 78 ~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~ 108 (117)
T d1wfoa1 78 RQYTATGLKPESVYLFRITAQTRKGWGEAAE 108 (117)
T ss_dssp CEEEEESCCSSSEEEEEEEEECSSCEEEEEE
T ss_pred EEEEECCCCCCCEEEEEEEEECCCcCCCCcC
Confidence 8899999999999999999999999998773
|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|