Diaphorina citri psyllid: psy1763

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----

MPLDELLAMYGYNEHNNERSPSHGNPLAPPVSDPLMLDEEIEDDDEEEEEEEKQPVSQLAKLYEEGCSTSSKETALSKALEEDDDEYNFFDEHPDDDDDDPKKTIMVGSEYQAWIPEGMCKYGDILPYENDDKLLWDPNHNLVTVDLVETYLKKSHEMFINGAGDCLPMGSHSRDDEQALYLLLQCGYNTEEALRRASMQSVPNPDTTSMWSEEECKNFESGLRMYGKNFYQIHQNKVKTRNVGEIVQFYYLWKKTERHDVFANKARLEKKKYSLHPGITDYMDRFLDEQEGSINPPASPNVYLMSESSKRQRNSSLGNKTTPPEETKTDKEGATSTPAAQQPANTSQSLPQTQTTPTSSAEEKT

ccHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccHHHHHcccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MPLDELLA************************************************************************************************IMVGSEYQAWIPEGMCKYGDILPYENDDKLLWDPNHNLVTVDLVETYLKKSHEMFINGAGDCLPMGSHSRDDEQALYLLLQCGYNTEEALRRASMQSVPNPDTTSMWSEEECKNFESGLRMYGKNFYQIHQNKVKTRNVGEIVQFYYLWKKTERHDVFANKARLEKKKYSLHPGITDYMDRFL******************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mesoderm induction early response protein 1	Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.	confident	Q5REE1
Mesoderm induction early response protein 1	Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.	confident	Q5UAK0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000118 [CC]	histone deacetylase complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XAG, chain B
Confidence level:very confident
Coverage over the Query: 211-255
View the alignment between query and template
View the model in PyMOL