Diaphorina citri psyllid: psy17649

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------

MKLRKLLIQSSIREFQKRGYKGLLGKYLVLSDDDKAKTFENDEKLPSLPVPPLDVTLEKYIQSVKPFATQEELTNVQNLAKEFKNGIGQELHKSLLKKASEEKNWLSGWWEKYAYLMSRDSLIPFYNMFGPNPTEELGLEYGPGKGVEHASLFCHELIKFWFLLRKEKLKPQLGTGDKPFCMHTFKKFFNTARIPGEEIDSIVNYFKTEAEGSCPSHVIVQCNGHIYKMNALHKDSTPLTVGEWKHQFNSILQASSKSKGSGIAALSCEPRSKWAENRSYILQKSAKNKQLIEDIDSAMFSVSLDNTSPTNDSEICQQLISNDYANRYADKSVAVVFFKNGASGGICEHTPFDGMVNVTACFYVLLSLAENLATISEDKTVRGGLEAPVPLEFDTDDQITKELSRAKAEQKISRYEISAIRKAFTGFGKAEITELKLHPDSFVQMALQLAYYTIHNK

cccccHHHHcccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEccccccccHHHHHHHHHcccccccccccEEEccccccccccccEEEEEEccEEEEEEEEccccccccHHHHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHHccccHHHHHHHHHHcccEEEccccccccHHHHHHHHHcccccccccccccEEEEECcccEEEEECccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEECccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHccccHHHHHHHHHHHHHHHHHcc

******LIQSSIREFQKRGYKGLLGKYLVLSD************LPSLPVPPLDVTLEKYIQSVKPFATQEELTNVQNLAKEFKNGIGQELHKSLLKKASEEKNWLSGWWEKYAYLMSRDSLIPFYNMFGPNPTEELGLEYGPGKGVEHASLFCHELIKFWFLLRKEKLKPQLGTGDKPFCMHTFKKFFNTARIPGEEIDSIVNYFKTEAEGSCPSHVIVQCNGHIYKMNALHKDSTPLTVGEWKHQFNSILQASSKSKGSGIAALSCEPRSKWAENRSYILQKSAKNKQLIEDIDSAMFSVSLDNTSPTNDSEICQQLISNDYANRYADKSVAVVFFKNGASGGICEHTPFDGMVNVTACFYVLLSLAENLATISEDKTVRGGLEAPVPLEFDTDDQITKELSRAKAEQKISRYEISAIRKAFTGFGKAEITELKLHPDSFVQMALQLAYYTIHN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peroxisomal carnitine O-octanoyltransferase	Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate.	confident	Q9DC50
Peroxisomal carnitine O-octanoyltransferase	Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate.	confident	P11466
Peroxisomal carnitine O-octanoyltransferase	Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.	confident	Q9UKG9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006091 [BP]	generation of precursor metabolites and energy	probable	GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0006635 [BP]	fatty acid beta-oxidation	probable	GO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0008458 [MF]	carnitine O-octanoyltransferase activity	probable	GO:0016740, GO:0003824, GO:0016414, GO:0016415, GO:0016746, GO:0016747, GO:0008374, GO:0003674, GO:0016406
GO:0005777 [CC]	peroxisome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015908 [BP]	fatty acid transport	probable	GO:0051234, GO:0015718, GO:0006869, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0006820, GO:0044699, GO:0046942
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051791 [BP]	medium-chain fatty acid metabolic process	probable	GO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XL7, chain A
Confidence level:very confident
Coverage over the Query: 36-425,437-457
View the alignment between query and template
View the model in PyMOL