Diaphorina citri psyllid: psy17655


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MKVDLIRNRGVALVYVGQPLDTVKVKMQTYPQLYSSMIDCCKKVWRDEGLVREISKKEACNVFVYKSS
ccEEEEEccccEEEEEccccEEEEEEccccccccccHHHHHHHHHHHcccccccccccccEEEEEEcc
MKVDLIRNRGVALVYVGQPLDTVKVKMQTYPQLYSSMIDCCKKVWRDEGLVREISKKEACNVFVYK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVDLIRNRGVALVYVGQPLDTVKVKMQTYPQLYSSMIDCCKKVWRDEGLVREISKKEACNVFVYKSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial ornithine transporter 1 Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.confidentQ9WVD5
Mitochondrial ornithine transporter 1 Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.confidentQ9Y619

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 1-67
View the alignment between query and template
View the model in PyMOL