Diaphorina citri psyllid: psy17660


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
FSRSCVGGNRFFVSNFQSEKSNDLRFESRFESGNLAKAVKISDNYYELYLRTDLYTNRHMQWFYFRINNTRANVYYRFSIVNLSKSESLYSVGMKPLMYSTKEAELNKIGWRRCGENITYFRNDLR
cccccccccccccccccccccccEEEEEccccccccEEEEEccEEEEEEEEcccccccEEEEEEEEEEEEccccEEEEEEEECcccccccccccccEEEEHHHHHHccccEEECcccEEEEccccc
*S*S******FFV*****EKSNDLRFESRFESGNLAKAVKISDNYYELYLRTDLYTNRHMQWFYFRINNTRANVYYRFSIVNLSKSESLYSVGMKPLMYSTKEAELNKIGWRRCGENITYFRNDL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSRSCVGGNRFFVSNFQSEKSNDLRFESRFESGNLAKAVKISDNYYELYLRTDLYTNRHMQWFYFRINNTRANVYYRFSIVNLSKSESLYSVGMKPLMYSTKEAELNKIGWRRCGENITYFRNDLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytosolic carboxypeptidase 2 Metallocarboxypeptidase that may play a role in the processing of tubulin.confidentQ5U5Z8
Cytosolic carboxypeptidase 2 Metallocarboxypeptidase.confidentA6H8T7
Cytosolic carboxypeptidase 2 Metallocarboxypeptidase.confidentQ0P4M4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035609 [BP]C-terminal protein deglutamylationprobableGO:0044267, GO:0018410, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0043687, GO:0009987, GO:0035608, GO:0018200, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0004181 [MF]metallocarboxypeptidase activityprobableGO:0016787, GO:0003824, GO:0004180, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0015631 [MF]tubulin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0035610 [BP]protein side chain deglutamylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0035608, GO:0018200, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A37, chain A
Confidence level:very confident
Coverage over the Query: 24-117
View the alignment between query and template
View the model in PyMOL