Diaphorina citri psyllid: psy17671


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSYSKFTFQSCPPIEMQGEVVGNLERFVLEPAAQKVSYKCRITRDRKGVDRGLYPTYFLHLERDYGKKPIEMQGEVVGNLERFVLEPAAQKVSYKCRITRDRKGVDRGLYPTYFLHLERDYGKKIFLLAGRKRKKSTTSNYLISTDPTDLSRKGESFVGKLRSNLLGTQFTVYDNGSSRRRVNIFDRDEQVKVRQELAAIIYVSIKSNREFICVFVDITALLSDFFAINFHLSRIFLHWQCRHWSLLD
ccccccccccccccccccHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccHHHHHcccccccccEEEEEEEcccccccccccccccEEEEcccccEEEEEEEEccccccccEEEEccccccccccccCEEEEcccccccEEEEEccccccccccccccccccccccEEEEEEEccccccEEEEEEEccccccccccccccccccccccccccccccccc
********QSCPPIEMQGEVVGNLERFVLEPAAQKVSYKCRITRDRKGVDRGLYPTYFLHLERDYGKKPIEMQGEVVGNLERFVLEPAAQKVSYKCRITRDRKGVDRGLYPTYFLHLERDYGKKIFLLAGRKRKKSTTSNYLISTDPTDLSRKGESFVGKLRSNLLGTQFTVYDNGSSRRRV*IFDR**QVKVRQELAAIIYVSIKSNREFICVFVDITALLS*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSKFTFQSCPPIEMQGEVVGNLERFVLEPAAQKVSYKCRITRDRKGVDRGLYPTYFLHLERDYGKKPIEMQGEVVGNLERFVLEPAAQKVSYKCRITRDRKGVDRGLYPTYFLHLERDYGKKIFLLAGRKRKKSTTSNYLISTDPTDLSRKGESFVGKLRSNLLGTQFTVYDNGSSRRRVNIFDRDEQVKVRQELAAIIYVSIKSNREFICVFVDITALLSDFFAINFHLSRIFLHWQCRHWSLLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein king tubby confidentQ28X18
Protein king tubby confidentQ7PZK5
Tubby protein homolog Functions in signal transduction from heterotrimeric G protein-coupled receptors. Binds to membranes containing phosphatidylinositol 4,5-bisphosphate. Can bind DNA (in vitro). May contribute to the regulation of transcription in the nucleus. Could be involved in the hypothalamic regulation of body weight (By similarity). Contribute to stimulation of phagocytosis of apoptotic retinal pigment epithelium (RPE) cells and macrophages.confidentP50607

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008277 [BP]regulation of G-protein coupled receptor protein signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005546 [MF]phosphatidylinositol-4,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0009584 [BP]detection of visible lightprobableGO:0009581, GO:0009582, GO:0009583, GO:0051606, GO:0009605, GO:0009628, GO:0009314, GO:0050896, GO:0009416, GO:0008150
GO:0007601 [BP]visual perceptionprobableGO:0032501, GO:0044707, GO:0050877, GO:0007600, GO:0050953, GO:0008150, GO:0044699, GO:0003008
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699
GO:0050766 [BP]positive regulation of phagocytosisprobableGO:0051130, GO:0050764, GO:0032879, GO:0051050, GO:0051049, GO:0060627, GO:0065007, GO:0048518, GO:0008150, GO:0045807, GO:0051128, GO:0030100, GO:0050789, GO:0050794, GO:0048522
GO:0001917 [CC]photoreceptor inner segmentprobableGO:0005575, GO:0044464, GO:0005623
GO:0060041 [BP]retina development in camera-type eyeprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0008020 [MF]G-protein coupled photoreceptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0009881
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0001750 [CC]photoreceptor outer segmentprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0045879 [BP]negative regulation of smoothened signaling pathwayprobableGO:0008589, GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0045202 [CC]synapseprobableGO:0005575
GO:0030991 [CC]intraflagellar transport particle AprobableGO:0043234, GO:0030990, GO:0032991, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0043226, GO:0005575, GO:0044447, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 80-241
View the alignment between query and template
View the model in PyMOL
Template: 3C5N, chain A
Confidence level:very confident
Coverage over the Query: 24-74
View the alignment between query and template
View the model in PyMOL