Diaphorina citri psyllid: psy17688


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MAGHASGVPPTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
ccccccccccccccCEEEECccccEEEEECccccccccEEEEEEEEcccccEEEEEEEccccccccEEEEECccccccEEEEccccccccccEEEEcccEEEEEEccccccccEEEccccccccccccCEEECccccccccEEEECccccEEEEccccccEEccccccccccEEEEEcccccEEEEEECcccccccEEEEEccccCEEEEEcccccccCEEEcccccccEEEECcccccccEEEEEEEcccEEEEEEccccccccEEEccccccEEEEEEccccccEEEEECccccEEEEEcccccccccccEEEEEcccccEEEEEEccccccEEEEEEcccEEEEEc
**************EIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGHASGVPPTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DDB1- and CUL4-associated factor 7 Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches (By similarity). Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.very confidentP61962
DDB1- and CUL4-associated factor 7 Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.very confidentP61963
DDB1- and CUL4-associated factor 7 homolog very confidentQ552R1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0080008 [CC]Cul4-RING ubiquitin ligase complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048731 [BP]system developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0044212 [MF]transcription regulatory region DNA bindingconfidentGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0050789 [BP]regulation of biological processconfidentGO:0008150, GO:0065007
GO:0050896 [BP]response to stimulusconfidentGO:0008150
GO:0005515 [MF]protein bindingconfidentGO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0032314 [BP]regulation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0048583, GO:0035020, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032319, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0009957 [BP]epidermal cell fate specificationprobableGO:0032502, GO:0032501, GO:0045165, GO:0044707, GO:0009913, GO:0048869, GO:0001708, GO:0060429, GO:0009888, GO:0008150, GO:0048513, GO:0044763, GO:0030855, GO:0030154, GO:0048731, GO:0009987, GO:0008544, GO:0007275, GO:0044699, GO:0048856
GO:0009733 [BP]response to auxin stimulusprobableGO:0009719, GO:0009725, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0043153 [BP]entrainment of circadian clock by photoperiodprobableGO:0009628, GO:0009605, GO:0009314, GO:0050896, GO:0042752, GO:0065007, GO:0009416, GO:0009649, GO:0009648, GO:0008150, GO:0050789
GO:0060101 [BP]negative regulation of phagocytosis, engulfmentprobableGO:0050764, GO:0050765, GO:0051051, GO:0050794, GO:0051049, GO:0008150, GO:0009987, GO:0051129, GO:0060627, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0060099, GO:0048519, GO:0032879, GO:0045806, GO:0030100, GO:0050789, GO:0048523
GO:0010026 [BP]trichome differentiationprobableGO:0032502, GO:0030154, GO:0044707, GO:0009913, GO:0048869, GO:0032501, GO:0060429, GO:0009888, GO:0008150, GO:0048513, GO:0044763, GO:0030855, GO:0048731, GO:0009987, GO:0008544, GO:0007275, GO:0044699, GO:0048856
GO:0048573 [BP]photoperiodism, floweringprobableGO:0032502, GO:0009628, GO:0048856, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0009314, GO:0050896, GO:0010228, GO:0009791, GO:0003006, GO:0032501, GO:0009416, GO:0008150, GO:0009648, GO:0048731, GO:0007275, GO:0044699
GO:0030336 [BP]negative regulation of cell migrationprobableGO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0030516 [BP]regulation of axon extensionprobableGO:0022604, GO:0048638, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051128, GO:0016043, GO:0061387, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0040008, GO:0060284, GO:0090066, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0065008, GO:0031344, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0001558, GO:0044763, GO:0010975, GO:0048731, GO:0022008, GO:0048699, GO:0050770, GO:0007399, GO:0048856, GO:0008361, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0032535
GO:0009723 [BP]response to ethylene stimulusprobableGO:0009719, GO:0009725, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0006612 [BP]protein targeting to membraneprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0006605, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0010363 [BP]regulation of plant-type hypersensitive responseprobableGO:0050776, GO:0045088, GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0008150, GO:0043067, GO:0002682, GO:0065007, GO:0010941, GO:0050789, GO:0031347
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0009963 [BP]positive regulation of flavonoid biosynthetic processprobableGO:0009893, GO:0080090, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031328, GO:0009889, GO:0009962, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0009718 [BP]anthocyanin-containing compound biosynthetic processprobableGO:1901576, GO:0044710, GO:0042440, GO:0046283, GO:0009812, GO:0009813, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0046148
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051216 [BP]cartilage developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XYI, chain A
Confidence level:very confident
Coverage over the Query: 10-349
View the alignment between query and template
View the model in PyMOL