Psyllid ID: psy17688


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MAGHASGVPPTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
ccccccccccccccEEEEEEccccEEEEEEccccccccEEEEEEEEcccccEEEEEEEccccccccEEEEEEccccccEEEEccccccccccEEEEcccEEEEEEccccccccEEEccccccccccccEEEEEccccccccEEEEEccccEEEEccccccEEccccccccccEEEEEcccccEEEEEEEcccccccEEEEEccccEEEEEEcccccccEEEEcccccccEEEEEcccccccEEEEEEEcccEEEEEEccccccccEEEccccccEEEEEEccccccEEEEEEccccEEEEEcccccccccccEEEEEcccccEEEEEEccccccEEEEEEcccEEEEEc
ccccccccccccccccEEEccccEEEEEEccccccccEEEEEEEcccccccEEEEEEcccccccEEEEEEEcccccccEEEEccccccccccEEEEcccEEEEEEccccccccHHHEcccccccccccccEcccccccccEEEEEccccEEEEEEEcccccccEEccccccEEEEEEEccccEEEEEEccccccccEEEEEcccccEEEEEccccccccEEEcccccccEEEEccccccccEEEEEEccccEEEEEEcccccccEEEEccccccEcEEEEccccccEEEEEccccEEEEEEccccccccccccEEEEccccEEccEEEccccccEEEEEEcccEEEEEc
maghasgvppttqkeiykyeapwplysmnwsvrpdKLFRLAIGSYVEEYNNKVQIVALNedisefgpkstidhpypttkimwipdrkgvfpdllatsgdylrvwragepetrlecilnnnknsdfcapltsfdwnevdpnllgtssidttCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIafsragggrdmfasvgaegsvrmfdlrhlehstiiyedpqhtpllrlawnkqdpnYLAMVAMNACEVIIldvrvpctpvarlnnhracvngiawaphsschictagddHQALIWDIQqmpraiedPILAYTaaggeinqiqwgatqpDWIAICYNKYLEVLRV
maghasgvppttqkEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISefgpkstidhpypttKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
MAGHASGVPPTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
**************EIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVL**
******************YEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPE*************DFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQ*********GHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHS****EDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMP***EDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
**********TTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
************QKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGHASGVPPTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query349 2.2.26 [Sep-21-2011]
P61963342 DDB1- and CUL4-associated yes N/A 0.962 0.982 0.860 1e-175
P61962342 DDB1- and CUL4-associated yes N/A 0.962 0.982 0.860 1e-175
Q552R1325 DDB1- and CUL4-associated yes N/A 0.919 0.987 0.584 1e-116
Q9LPV9346 WD repeat-containing prot yes N/A 0.919 0.927 0.573 1e-109
Q38960346 WD repeat-containing prot no N/A 0.925 0.933 0.553 1e-106
Q9XGN1341 Protein TRANSPARENT TESTA no N/A 0.899 0.920 0.519 2e-92
Q12523523 WD repeat-containing prot yes N/A 0.939 0.627 0.316 3e-50
O74763435 Uncharacterized WD repeat yes N/A 0.919 0.737 0.339 7e-49
Q75C99423 Histone acetyltransferase no N/A 0.424 0.349 0.254 1e-09
Q9XF57317 Peroxisome biogenesis pro no N/A 0.446 0.492 0.275 6e-07
>sp|P61963|DCAF7_MOUSE DDB1- and CUL4-associated factor 7 OS=Mus musculus GN=Dcaf7 PE=2 SV=1 Back     alignment and function desciption
 Score =  613 bits (1581), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 290/337 (86%), Positives = 311/337 (92%), Gaps = 1/337 (0%)

Query: 13  QKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTID 72
           +KEIYKYEAPW +Y+MNWSVRPDK FRLA+GS+VEEYNNKVQ+V L+E+ SEF  ++T D
Sbjct: 7   RKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFD 66

Query: 73  HPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSF 132
           HPYPTTK+MWIPD KGV+PDLLATSGDYLRVWR GE ETRLEC+LNNNKNSDFCAPLTSF
Sbjct: 67  HPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSF 126

Query: 133 DWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAG 192
           DWNEVDP LLGTSSIDTTCTIW LET QV+GRVN VSGHVKTQLIAHDKEVYDIAFSRAG
Sbjct: 127 DWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAG 186

Query: 193 GGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACE 252
           GGRDMFASVGA+GSVRMFDLRHLEHSTIIYEDPQH PLLRL WNKQDPNYLA +AM+  E
Sbjct: 187 GGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGME 246

Query: 253 VIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDP 312
           V+ILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTA DDHQALIWDIQQMPRAIEDP
Sbjct: 247 VVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDP 306

Query: 313 ILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV 349
           ILAYTA  GEIN +QW +TQPDWIAICYN  LE+LRV
Sbjct: 307 ILAYTAE-GEINNVQWASTQPDWIAICYNNCLEILRV 342




Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Mus musculus (taxid: 10090)
>sp|P61962|DCAF7_HUMAN DDB1- and CUL4-associated factor 7 OS=Homo sapiens GN=DCAF7 PE=1 SV=1 Back     alignment and function description
>sp|Q552R1|DCAF7_DICDI DDB1- and CUL4-associated factor 7 homolog OS=Dictyostelium discoideum GN=wdr68 PE=3 SV=2 Back     alignment and function description
>sp|Q9LPV9|LWD1_ARATH WD repeat-containing protein LWD1 OS=Arabidopsis thaliana GN=LWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q38960|LWD2_ARATH WD repeat-containing protein LWD2 OS=Arabidopsis thaliana GN=LWD2 PE=2 SV=1 Back     alignment and function description
>sp|Q9XGN1|TTG1_ARATH Protein TRANSPARENT TESTA GLABRA 1 OS=Arabidopsis thaliana GN=TTG1 PE=1 SV=1 Back     alignment and function description
>sp|Q12523|YP247_YEAST WD repeat-containing protein YPL247C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL247C PE=1 SV=1 Back     alignment and function description
>sp|O74763|YBE8_SCHPO Uncharacterized WD repeat-containing protein C17D11.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17D11.08 PE=1 SV=1 Back     alignment and function description
>sp|Q75C99|HAT2_ASHGO Histone acetyltransferase type B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT2 PE=3 SV=1 Back     alignment and function description
>sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
328701670346 PREDICTED: DDB1- and CUL4-associated fac 0.991 1.0 0.905 0.0
91090262348 PREDICTED: similar to CG14614 CG14614-PA 0.994 0.997 0.893 0.0
307202521346 WD repeat-containing protein 68 [Harpegn 0.991 1.0 0.896 0.0
383861073346 PREDICTED: DDB1- and CUL4-associated fac 0.991 1.0 0.896 0.0
345498172346 PREDICTED: LOW QUALITY PROTEIN: DDB1- an 0.991 1.0 0.891 0.0
48102495346 PREDICTED: DDB1- and CUL4-associated fac 0.991 1.0 0.893 0.0
307178349346 WD repeat-containing protein 68 [Campono 0.991 1.0 0.888 0.0
357614716351 hypothetical protein KGM_12904 [Danaus p 0.965 0.960 0.893 0.0
332028797360 WD repeat-containing protein 68 [Acromyr 0.991 0.961 0.88 0.0
157128695399 hypothetical protein AaeL_AAEL011196 [Ae 0.965 0.844 0.893 0.0
>gi|328701670|ref|XP_001946026.2| PREDICTED: DDB1- and CUL4-associated factor 7-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/349 (90%), Positives = 332/349 (95%), Gaps = 3/349 (0%)

Query: 1   MAGHASGVPPTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNE 60
           MA H S      +KEIYK+EAPWPLYSMNWSVRPDK FRLAIGS+VEEYNNKVQIV+L+E
Sbjct: 1   MAVHGST---PKRKEIYKHEAPWPLYSMNWSVRPDKRFRLAIGSFVEEYNNKVQIVSLDE 57

Query: 61  DISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNN 120
           ++SEF PKST DHPYPTTKIMWIPD KGVFPDLLATSGDYLR+WRAGEPETRLECILNNN
Sbjct: 58  EVSEFSPKSTFDHPYPTTKIMWIPDSKGVFPDLLATSGDYLRIWRAGEPETRLECILNNN 117

Query: 121 KNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHD 180
           KNSDFCAPLTSFDWNEVDPNL+GTSSIDTTCTIW LET Q+VGR+NSV+GHVKTQLIAHD
Sbjct: 118 KNSDFCAPLTSFDWNEVDPNLIGTSSIDTTCTIWGLETTQIVGRINSVAGHVKTQLIAHD 177

Query: 181 KEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDP 240
           KEVYDIAFSRAGGGRDMFASVGA+GSVRMFDLRHLEHSTIIYEDPQH+PLLRLAWNKQDP
Sbjct: 178 KEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHSPLLRLAWNKQDP 237

Query: 241 NYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIW 300
           NYLA VAM+ACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIW
Sbjct: 238 NYLATVAMDACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIW 297

Query: 301 DIQQMPRAIEDPILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV 349
           DIQQMPRAIEDPILAYTAA GEINQIQWGATQPDWIAICYNK LE+LRV
Sbjct: 298 DIQQMPRAIEDPILAYTAAEGEINQIQWGATQPDWIAICYNKSLEILRV 346




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91090262|ref|XP_966430.1| PREDICTED: similar to CG14614 CG14614-PA isoform 1 [Tribolium castaneum] gi|270013432|gb|EFA09880.1| hypothetical protein TcasGA2_TC012028 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307202521|gb|EFN81883.1| WD repeat-containing protein 68 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383861073|ref|XP_003706011.1| PREDICTED: DDB1- and CUL4-associated factor 7 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345498172|ref|XP_003428167.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor 7-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|48102495|ref|XP_395370.1| PREDICTED: DDB1- and CUL4-associated factor 7-like [Apis mellifera] gi|340726321|ref|XP_003401508.1| PREDICTED: DDB1- and CUL4-associated factor 7-like [Bombus terrestris] gi|350423887|ref|XP_003493621.1| PREDICTED: DDB1- and CUL4-associated factor 7-like [Bombus impatiens] gi|380024294|ref|XP_003695936.1| PREDICTED: DDB1- and CUL4-associated factor 7 [Apis florea] Back     alignment and taxonomy information
>gi|307178349|gb|EFN67103.1| WD repeat-containing protein 68 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357614716|gb|EHJ69229.1| hypothetical protein KGM_12904 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332028797|gb|EGI68826.1| WD repeat-containing protein 68 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157128695|ref|XP_001655183.1| hypothetical protein AaeL_AAEL011196 [Aedes aegypti] gi|108872518|gb|EAT36743.1| AAEL011196-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
UNIPROTKB|Q5ZIT1342 DCAF7 "Uncharacterized protein 0.962 0.982 0.860 7.1e-164
UNIPROTKB|Q32L87342 WDR68 "WD repeat domain 68" [B 0.962 0.982 0.860 7.1e-164
UNIPROTKB|E2REP1342 DCAF7 "Uncharacterized protein 0.962 0.982 0.860 7.1e-164
UNIPROTKB|P61962342 DCAF7 "DDB1- and CUL4-associat 0.962 0.982 0.860 7.1e-164
UNIPROTKB|F2Z564342 DCAF7 "Uncharacterized protein 0.962 0.982 0.860 7.1e-164
MGI|MGI:1919083342 Dcaf7 "DDB1 and CUL4 associate 0.962 0.982 0.860 7.1e-164
ZFIN|ZDB-GENE-030131-9511342 dcaf7 "ddb1 and cul4 associate 0.962 0.982 0.857 7.1e-164
DICTYBASE|DDB_G0275925325 wdr68 "WD40 repeat-containing 0.919 0.987 0.584 2.4e-108
TAIR|locus:2010356346 ATAN11 "AT1G12910" [Arabidopsi 0.919 0.927 0.573 6e-103
TAIR|locus:2090792346 LWD2 "AT3G26640" [Arabidopsis 0.919 0.927 0.559 7.1e-100
UNIPROTKB|Q5ZIT1 DCAF7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1595 (566.5 bits), Expect = 7.1e-164, P = 7.1e-164
 Identities = 290/337 (86%), Positives = 311/337 (92%)

Query:    13 QKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTID 72
             +KEIYKYEAPW +Y+MNWSVRPDK FRLA+GS+VEEYNNKVQ+V L+E+ SEF  ++T D
Sbjct:     7 RKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFD 66

Query:    73 HPYPTTKIMWIPDRKGVFPDLLATSGDYLRVWRAGEPETRLECILNNNKNSDFCAPLTSF 132
             HPYPTTK+MWIPD KGV+PDLLATSGDYLRVWR GE ETRLEC+LNNNKNSDFCAPLTSF
Sbjct:    67 HPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSF 126

Query:   133 DWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRAG 192
             DWNEVDP LLGTSSIDTTCTIW LET QV+GRVN VSGHVKTQLIAHDKEVYDIAFSRAG
Sbjct:   127 DWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAG 186

Query:   193 GGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACE 252
             GGRDMFASVGA+GSVRMFDLRHLEHSTIIYEDPQH PLLRL WNKQDPNYLA +AM+  E
Sbjct:   187 GGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGME 246

Query:   253 VIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDP 312
             V+ILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTA DDHQALIWDIQQMPRAIEDP
Sbjct:   247 VVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDP 306

Query:   313 ILAYTAAGGEINQIQWGATQPDWIAICYNKYLEVLRV 349
             ILAYTA G EIN +QW +TQPDWIAICYN  LE+LRV
Sbjct:   307 ILAYTAEG-EINNVQWASTQPDWIAICYNNCLEILRV 342




GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|Q32L87 WDR68 "WD repeat domain 68" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2REP1 DCAF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61962 DCAF7 "DDB1- and CUL4-associated factor 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z564 DCAF7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1919083 Dcaf7 "DDB1 and CUL4 associated factor 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9511 dcaf7 "ddb1 and cul4 associated factor 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275925 wdr68 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2010356 ATAN11 "AT1G12910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090792 LWD2 "AT3G26640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74763YBE8_SCHPONo assigned EC number0.33900.91970.7379yesN/A
Q38960LWD2_ARATHNo assigned EC number0.55330.92550.9335noN/A
Q9LPV9LWD1_ARATHNo assigned EC number0.57390.91970.9277yesN/A
Q552R1DCAF7_DICDINo assigned EC number0.58400.91970.9876yesN/A
Q9XGN1TTG1_ARATHNo assigned EC number0.51900.89970.9208noN/A
P61962DCAF7_HUMANNo assigned EC number0.86050.96270.9824yesN/A
P61963DCAF7_MOUSENo assigned EC number0.86050.96270.9824yesN/A
Q12523YP247_YEASTNo assigned EC number0.31660.93980.6271yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-12
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-10
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-10
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-06
smart0032040 smart00320, WD40, WD40 repeats 1e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 66.2 bits (162), Expect = 3e-12
 Identities = 60/313 (19%), Positives = 107/313 (34%), Gaps = 69/313 (22%)

Query: 24  PLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWI 83
            +  + +S        LA GS     +  +++  L         K    H  P   +   
Sbjct: 11  GVTCVAFSPDGK---LLATGSG----DGTIKVWDLETGELLRTLKG---HTGPVRDVAAS 60

Query: 84  PDRKGVFPDLLATSGD--YLRVW--RAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDP 139
            D        LA+      +R+W    GE    L             + ++S  ++  D 
Sbjct: 61  ADGT-----YLASGSSDKTIRLWDLETGECVRTLTG---------HTSYVSSVAFS-PDG 105

Query: 140 NLLGTSSIDTTCTIWCLETNQVV-------GRVNSV------------------------ 168
            +L +SS D T  +W +ET + +         VNSV                        
Sbjct: 106 RILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLR 165

Query: 169 SGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHT 228
           +G     L  H  EV  +AFS    G  + +S  ++G+++++DL   +    +       
Sbjct: 166 TGKCVATLTGHTGEVNSVAFS--PDGEKLLSS-SSDGTIKLWDLSTGKCLGTLRGHEN-- 220

Query: 229 PLLRLAWNKQDPNYLAMVAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHI 288
            +  +A++     YL         + + D+R     V  L+ H   V  +AW+P     +
Sbjct: 221 GVNSVAFS--PDGYLLASGSEDGTIRVWDLR-TGECVQTLSGHTNSVTSLAWSP-DGKRL 276

Query: 289 CTAGDDHQALIWD 301
            +   D    IWD
Sbjct: 277 ASGSADGTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 349
KOG0290|consensus364 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0277|consensus311 100.0
KOG0286|consensus343 100.0
KOG0271|consensus480 100.0
KOG0284|consensus464 100.0
KOG0315|consensus311 100.0
KOG0272|consensus459 100.0
KOG0264|consensus422 100.0
KOG0273|consensus524 100.0
KOG0273|consensus524 100.0
KOG0295|consensus406 100.0
KOG0279|consensus315 100.0
KOG0263|consensus707 100.0
KOG0279|consensus315 100.0
KOG0263|consensus707 100.0
KOG0286|consensus343 100.0
KOG0318|consensus603 100.0
KOG0313|consensus423 100.0
KOG0645|consensus312 100.0
KOG0285|consensus460 100.0
KOG0265|consensus338 100.0
KOG0266|consensus456 100.0
KOG0265|consensus338 100.0
KOG0296|consensus399 100.0
KOG0319|consensus 775 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0318|consensus603 100.0
KOG0291|consensus 893 100.0
KOG0291|consensus 893 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0293|consensus519 100.0
KOG0284|consensus 464 100.0
KOG0319|consensus 775 100.0
KOG0282|consensus503 100.0
KOG0281|consensus499 100.0
KOG0315|consensus311 100.0
KOG0641|consensus350 100.0
KOG0292|consensus 1202 100.0
KOG0310|consensus 487 100.0
KOG0316|consensus307 100.0
KOG0640|consensus430 100.0
KOG0295|consensus406 100.0
KOG0277|consensus311 100.0
KOG0645|consensus312 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0275|consensus508 100.0
KOG0264|consensus422 100.0
KOG0266|consensus456 100.0
KOG0285|consensus460 100.0
KOG0276|consensus 794 100.0
KOG0278|consensus334 100.0
KOG0772|consensus 641 100.0
KOG0302|consensus440 100.0
KOG0973|consensus 942 100.0
KOG0276|consensus 794 100.0
KOG0305|consensus484 100.0
KOG0316|consensus307 100.0
KOG1407|consensus313 100.0
KOG0647|consensus347 100.0
KOG0268|consensus433 100.0
KOG0288|consensus459 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0281|consensus499 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0305|consensus484 100.0
KOG0270|consensus463 100.0
KOG0269|consensus 839 100.0
KOG1036|consensus323 100.0
KOG0283|consensus 712 100.0
KOG0269|consensus 839 100.0
KOG1446|consensus311 100.0
KOG0292|consensus 1202 100.0
KOG0306|consensus 888 99.98
KOG0306|consensus 888 99.98
PTZ00421 493 coronin; Provisional 99.98
KOG0643|consensus327 99.98
KOG0313|consensus423 99.98
KOG0639|consensus705 99.97
KOG0296|consensus399 99.97
KOG0274|consensus537 99.97
KOG1407|consensus313 99.97
KOG1332|consensus299 99.97
KOG0282|consensus503 99.97
KOG1446|consensus311 99.97
KOG0308|consensus 735 99.97
KOG0293|consensus519 99.97
KOG0310|consensus 487 99.97
KOG0294|consensus362 99.97
KOG0299|consensus479 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0307|consensus 1049 99.97
KOG0772|consensus 641 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0640|consensus430 99.97
KOG0289|consensus506 99.97
KOG0647|consensus347 99.97
KOG2055|consensus514 99.97
KOG0300|consensus481 99.97
KOG0288|consensus459 99.97
KOG0289|consensus506 99.97
KOG1007|consensus370 99.97
KOG1539|consensus 910 99.97
KOG1408|consensus 1080 99.96
KOG2445|consensus361 99.96
KOG0278|consensus334 99.96
KOG0321|consensus 720 99.96
KOG4328|consensus498 99.96
KOG0641|consensus350 99.96
KOG1063|consensus 764 99.96
KOG0283|consensus 712 99.96
KOG0294|consensus362 99.96
KOG0275|consensus508 99.96
KOG1036|consensus323 99.96
KOG0643|consensus327 99.96
KOG0301|consensus 745 99.96
KOG2445|consensus361 99.96
KOG2048|consensus 691 99.96
KOG0299|consensus479 99.96
KOG4283|consensus397 99.95
KOG2096|consensus420 99.95
KOG0274|consensus537 99.95
KOG1332|consensus299 99.95
KOG0308|consensus 735 99.95
KOG0646|consensus 476 99.95
KOG1274|consensus 933 99.95
KOG0302|consensus440 99.95
KOG0270|consensus463 99.95
KOG0650|consensus733 99.95
KOG0300|consensus481 99.95
KOG2106|consensus 626 99.95
KOG4283|consensus 397 99.95
KOG1445|consensus 1012 99.95
KOG0973|consensus 942 99.94
KOG0267|consensus 825 99.94
KOG4378|consensus 673 99.94
KOG0646|consensus 476 99.94
KOG0268|consensus433 99.94
KOG1539|consensus 910 99.94
KOG1273|consensus405 99.94
KOG4378|consensus 673 99.94
KOG2919|consensus406 99.94
KOG4328|consensus498 99.94
KOG1007|consensus370 99.94
KOG0301|consensus 745 99.94
KOG1034|consensus385 99.94
KOG2106|consensus 626 99.94
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.93
KOG1009|consensus434 99.93
KOG0307|consensus 1049 99.93
KOG0649|consensus325 99.93
KOG1063|consensus764 99.93
KOG1274|consensus 933 99.93
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.92
KOG0639|consensus705 99.92
KOG0321|consensus 720 99.92
KOG1408|consensus 1080 99.92
KOG2048|consensus 691 99.92
KOG1538|consensus 1081 99.92
KOG2096|consensus420 99.92
KOG1587|consensus555 99.92
KOG2919|consensus406 99.91
KOG4227|consensus 609 99.91
KOG0267|consensus 825 99.91
KOG0290|consensus364 99.9
KOG1273|consensus 405 99.9
KOG1034|consensus385 99.9
KOG0303|consensus 472 99.9
KOG2055|consensus514 99.89
KOG0303|consensus 472 99.89
KOG1188|consensus376 99.89
KOG0650|consensus733 99.88
PRK11028330 6-phosphogluconolactonase; Provisional 99.88
KOG1188|consensus 376 99.88
KOG0771|consensus398 99.88
KOG0322|consensus323 99.88
KOG1587|consensus555 99.87
KOG0642|consensus577 99.86
KOG1445|consensus 1012 99.86
KOG1517|consensus1387 99.86
KOG1523|consensus361 99.85
KOG0642|consensus577 99.85
COG2319 466 FOG: WD40 repeat [General function prediction only 99.84
KOG1963|consensus 792 99.84
KOG2321|consensus 703 99.83
KOG2110|consensus 391 99.83
KOG1517|consensus1387 99.83
KOG1523|consensus361 99.82
KOG2110|consensus391 99.82
KOG1272|consensus 545 99.82
KOG1538|consensus 1081 99.81
PRK11028330 6-phosphogluconolactonase; Provisional 99.81
KOG0280|consensus339 99.81
KOG1524|consensus 737 99.81
KOG0322|consensus323 99.81
KOG0644|consensus 1113 99.8
KOG1354|consensus433 99.8
KOG4227|consensus 609 99.8
KOG2111|consensus346 99.79
PRK01742429 tolB translocation protein TolB; Provisional 99.79
COG2319 466 FOG: WD40 repeat [General function prediction only 99.79
KOG2139|consensus445 99.78
KOG1240|consensus1431 99.78
KOG1524|consensus 737 99.78
KOG1310|consensus 758 99.78
KOG4497|consensus447 99.77
KOG1334|consensus559 99.77
KOG1310|consensus 758 99.77
KOG1272|consensus 545 99.76
KOG3881|consensus412 99.76
KOG3881|consensus412 99.76
KOG2111|consensus346 99.76
KOG2139|consensus445 99.75
KOG2394|consensus 636 99.75
KOG1009|consensus 434 99.75
KOG0649|consensus325 99.75
KOG1963|consensus 792 99.75
KOG0644|consensus 1113 99.73
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.73
KOG2394|consensus 636 99.72
PRK01742429 tolB translocation protein TolB; Provisional 99.72
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.71
KOG1409|consensus404 99.71
KOG1334|consensus 559 99.71
KOG4497|consensus 447 99.7
KOG1240|consensus1431 99.7
KOG0771|consensus398 99.7
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.68
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.67
PRK03629429 tolB translocation protein TolB; Provisional 99.67
KOG0309|consensus 1081 99.66
KOG2315|consensus 566 99.65
PRK03629429 tolB translocation protein TolB; Provisional 99.65
KOG0309|consensus 1081 99.65
KOG0280|consensus339 99.64
KOG2321|consensus 703 99.64
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.62
PRK04922433 tolB translocation protein TolB; Provisional 99.62
PRK04922433 tolB translocation protein TolB; Provisional 99.61
PRK02889427 tolB translocation protein TolB; Provisional 99.61
PRK05137435 tolB translocation protein TolB; Provisional 99.61
PRK05137435 tolB translocation protein TolB; Provisional 99.61
PRK02889427 tolB translocation protein TolB; Provisional 99.58
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.58
KOG4547|consensus 541 99.58
KOG1354|consensus433 99.58
KOG1409|consensus404 99.54
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.51
KOG0974|consensus 967 99.5
PRK00178430 tolB translocation protein TolB; Provisional 99.5
KOG4547|consensus 541 99.49
PRK01029428 tolB translocation protein TolB; Provisional 99.48
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.47
KOG2315|consensus 566 99.47
KOG2041|consensus 1189 99.46
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.46
PRK04792448 tolB translocation protein TolB; Provisional 99.46
KOG0974|consensus 967 99.45
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.44
PRK04792448 tolB translocation protein TolB; Provisional 99.43
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.4
PRK00178430 tolB translocation protein TolB; Provisional 99.39
KOG2314|consensus 698 99.38
KOG4532|consensus344 99.38
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.36
PRK01029428 tolB translocation protein TolB; Provisional 99.35
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.34
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.33
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.32
KOG1064|consensus2439 99.3
KOG4532|consensus344 99.27
KOG4714|consensus319 99.26
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.25
COG4946 668 Uncharacterized protein related to the periplasmic 99.24
KOG1064|consensus2439 99.23
KOG1912|consensus 1062 99.22
KOG2041|consensus 1189 99.22
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.22
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.21
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.21
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.21
KOG4714|consensus319 99.21
KOG3914|consensus390 99.18
COG4946668 Uncharacterized protein related to the periplasmic 99.17
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.15
KOG1912|consensus 1062 99.14
PRK04043419 tolB translocation protein TolB; Provisional 99.09
KOG1645|consensus463 99.09
PRK04043419 tolB translocation protein TolB; Provisional 99.07
KOG1008|consensus 783 99.04
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.04
KOG3914|consensus 390 99.04
KOG4190|consensus1034 99.03
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.03
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.02
KOG4190|consensus1034 99.01
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.0
KOG2314|consensus 698 98.94
KOG2695|consensus425 98.94
KOG1275|consensus 1118 98.94
KOG2695|consensus425 98.91
KOG0882|consensus 558 98.9
KOG3621|consensus 726 98.9
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.9
KOG1920|consensus 1265 98.87
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.85
KOG1832|consensus 1516 98.84
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.82
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.81
KOG1008|consensus 783 98.81
KOG1920|consensus 1265 98.76
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.76
KOG1275|consensus 1118 98.76
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.74
KOG3617|consensus 1416 98.68
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.65
KOG2114|consensus 933 98.63
KOG2066|consensus 846 98.62
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.6
KOG2066|consensus 846 98.6
KOG2114|consensus 933 98.59
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.57
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.52
KOG1645|consensus 463 98.52
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.51
KOG1832|consensus 1516 98.47
KOG0882|consensus 558 98.45
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.42
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.31
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.29
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.28
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.28
PRK02888 635 nitrous-oxide reductase; Validated 98.22
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.19
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.18
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.1
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.1
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.1
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.09
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.03
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.0
KOG3621|consensus 726 98.0
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.93
KOG3617|consensus 1416 97.93
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.92
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.87
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.84
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.81
KOG4640|consensus 665 97.81
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.76
KOG4640|consensus 665 97.75
KOG4649|consensus 354 97.71
KOG2395|consensus644 97.7
PRK02888 635 nitrous-oxide reductase; Validated 97.69
KOG2444|consensus238 97.67
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.66
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.66
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.63
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.57
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.56
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.56
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.56
PRK13616591 lipoprotein LpqB; Provisional 97.56
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.55
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.55
KOG1897|consensus 1096 97.54
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.5
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.38
KOG2079|consensus 1206 97.38
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.37
COG3391 381 Uncharacterized conserved protein [Function unknow 97.35
PF14727418 PHTB1_N: PTHB1 N-terminus 97.24
KOG4649|consensus354 97.21
COG3391381 Uncharacterized conserved protein [Function unknow 97.19
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.16
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.15
KOG2444|consensus238 97.1
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.06
PHA02713557 hypothetical protein; Provisional 97.03
KOG2395|consensus 644 97.01
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.97
KOG2079|consensus 1206 96.95
PRK13616591 lipoprotein LpqB; Provisional 96.87
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.78
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.73
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.63
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.62
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 96.61
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.55
KOG4441|consensus571 96.49
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.46
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.42
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.36
KOG3630|consensus 1405 96.35
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.34
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.29
KOG4441|consensus571 96.2
PRK10115 686 protease 2; Provisional 96.13
PHA02713557 hypothetical protein; Provisional 96.04
KOG2377|consensus 657 96.03
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.02
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.0
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.96
KOG3630|consensus 1405 95.87
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 95.84
KOG4499|consensus310 95.84
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.68
KOG2377|consensus 657 95.67
KOG1916|consensus 1283 95.61
KOG4460|consensus 741 95.58
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.47
KOG2247|consensus 615 95.47
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.42
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.35
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.32
KOG1916|consensus 1283 95.31
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.26
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 95.25
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 95.04
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.98
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.6
COG5167776 VID27 Protein involved in vacuole import and degra 94.53
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.35
KOG1898|consensus1205 94.29
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.24
PRK10115 686 protease 2; Provisional 94.13
PHA03098534 kelch-like protein; Provisional 94.01
PHA03098534 kelch-like protein; Provisional 93.95
COG5276370 Uncharacterized conserved protein [Function unknow 93.87
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.81
KOG2247|consensus 615 93.45
KOG2280|consensus 829 93.37
PF14727 418 PHTB1_N: PTHB1 N-terminus 93.22
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.94
KOG4499|consensus310 92.9
PHA02790480 Kelch-like protein; Provisional 92.9
KOG1900|consensus 1311 92.77
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 92.76
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.75
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.69
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.52
COG5276370 Uncharacterized conserved protein [Function unknow 92.49
COG5167 776 VID27 Protein involved in vacuole import and degra 92.33
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 92.11
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 92.03
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 91.97
COG4590 733 ABC-type uncharacterized transport system, permeas 91.82
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 91.74
PF12768281 Rax2: Cortical protein marker for cell polarity 91.53
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 91.03
KOG4460|consensus 741 90.94
KOG3616|consensus 1636 90.85
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.27
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 90.2
KOG1897|consensus 1096 89.46
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.46
KOG1896|consensus1366 89.18
COG4590 733 ABC-type uncharacterized transport system, permeas 88.86
PHA02790480 Kelch-like protein; Provisional 88.61
PRK13684334 Ycf48-like protein; Provisional 88.03
PF09826521 Beta_propel: Beta propeller domain; InterPro: IPR0 87.94
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 87.92
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 87.55
KOG1900|consensus 1311 86.56
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 86.37
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.11
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 86.09
KOG1898|consensus 1205 86.02
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 85.84
PRK13684334 Ycf48-like protein; Provisional 85.6
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 85.58
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.45
PF13449326 Phytase-like: Esterase-like activity of phytase 85.43
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 85.3
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 84.98
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 84.8
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 82.43
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 81.41
>KOG0290|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-50  Score=304.44  Aligned_cols=329  Identities=75%  Similarity=1.293  Sum_probs=299.7

Q ss_pred             ccccceeeeeecCCceeeEEEeecCCCceEEEEEeeecccCCeEEEEeccccccccccceEecCCCCeeEEEEecCCCCC
Q psy17688         10 PTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEFGPKSTIDHPYPTTKIMWIPDRKGV   89 (349)
Q Consensus        10 ~~~~~~~~~~~~~~~v~~~~~sp~~~~~~~la~g~~~~~~~g~i~i~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~   89 (349)
                      ..+.++++.|+.+++++++.||..++.+++||+|+..++.+++|.|..++++.+++.....+.|..+++.+.|.|+..+.
T Consensus        32 ~~r~~eiy~Y~ap~~lya~~Ws~~~~~~~rla~gS~~Ee~~Nkvqiv~ld~~s~e~~~~a~fd~~YP~tK~~wiPd~~g~  111 (364)
T KOG0290|consen   32 NPRRKEIYTYNAPWPLYAMNWSVRPDKKFRLAVGSFIEEYNNKVQIVQLDEDSGELVEDANFDHPYPVTKLMWIPDSKGV  111 (364)
T ss_pred             CcccceEEEecCCCceeeeccccCCCcceeEEEeeeccccCCeeEEEEEccCCCceeccCCCCCCCCccceEecCCcccc
Confidence            34678899999999999999998889999999999999999999999999999999888888999999999999999888


Q ss_pred             CCcEEEEeCCcEEEEECCC--CCchhheeccCCCCCCCcCceeEEEecCCCCCeEEEEEcCCeEEEEeccCcceeeeecc
Q psy17688         90 FPDLLATSGDYLRVWRAGE--PETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNS  167 (349)
Q Consensus        90 ~~~~l~~~~~~i~vw~~~~--~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~  167 (349)
                      .|++||+++|.+++|.+..  .....+..+..+++..++.++++++|+..+.+++.+++-|.+..|||++++..      
T Consensus       112 ~pdlLATs~D~LRlWri~~ee~~~~~~~~L~~~kns~~~aPlTSFDWne~dp~~igtSSiDTTCTiWdie~~~~------  185 (364)
T KOG0290|consen  112 YPDLLATSSDFLRLWRIGDEESRVELQSVLNNNKNSEFCAPLTSFDWNEVDPNLIGTSSIDTTCTIWDIETGVS------  185 (364)
T ss_pred             CcchhhcccCeEEEEeccCcCCceehhhhhccCcccccCCcccccccccCCcceeEeecccCeEEEEEEeeccc------
Confidence            8999999999999999984  44556667788888999999999999999999999999999999999999743      


Q ss_pred             cCCceeeeeeccCCceeeEEEecCCCCccEEEEEcCCCcEEEEECCCCCceeeeeeCCC-CCceeEEEEeCCCCCeEEEE
Q psy17688        168 VSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQ-HTPLLRLAWNKQDPNYLAMV  246 (349)
Q Consensus       168 ~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~-~~~v~~~~~~~~~~~~l~~~  246 (349)
                        +.....+.+|..+|.+++|...+.  +.||+.+.||.+|+||+|..+...++++.+. ..+...++|++++.+++|+-
T Consensus       186 --~~vkTQLIAHDKEV~DIaf~~~s~--~~FASvgaDGSvRmFDLR~leHSTIIYE~p~~~~pLlRLswnkqDpnymATf  261 (364)
T KOG0290|consen  186 --GTVKTQLIAHDKEVYDIAFLKGSR--DVFASVGADGSVRMFDLRSLEHSTIIYEDPSPSTPLLRLSWNKQDPNYMATF  261 (364)
T ss_pred             --cceeeEEEecCcceeEEEeccCcc--ceEEEecCCCcEEEEEecccccceEEecCCCCCCcceeeccCcCCchHHhhh
Confidence              123367899999999999998664  8999999999999999999999999988776 78899999999999999999


Q ss_pred             eeCCcEEEEEeccCCCcceeEeecCCcceEEEEEeeCCCCEEEEEcCCCcEEEEEeecCCC-CCCCcEEEEeccCCceEE
Q psy17688        247 AMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPR-AIEDPILAYTAAGGEINQ  325 (349)
Q Consensus       247 ~~d~~~i~v~d~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~~~~d~~v~iwd~~~~~~-~~~~~~~~~~~~~~~v~~  325 (349)
                      ..|.+.|.+.|+|.+..++.++++|++.|+.++|.|..+..+++++.|..+.+||+..... ....|+..+.. ++.|+.
T Consensus       262 ~~dS~~V~iLDiR~P~tpva~L~~H~a~VNgIaWaPhS~~hictaGDD~qaliWDl~q~~~~~~~dPilay~a-~~EVNq  340 (364)
T KOG0290|consen  262 AMDSNKVVILDIRVPCTPVARLRNHQASVNGIAWAPHSSSHICTAGDDCQALIWDLQQMPRENGEDPILAYTA-GGEVNQ  340 (364)
T ss_pred             hcCCceEEEEEecCCCcceehhhcCcccccceEecCCCCceeeecCCcceEEEEecccccccCCCCchhhhhc-cceeee
Confidence            8888789999999999999999999999999999999887799999999999999998776 66778888886 889999


Q ss_pred             EEEcCCCCceEEEEcCCeEEEeeC
Q psy17688        326 IQWGATQPDWIAICYNKYLEVLRV  349 (349)
Q Consensus       326 ~~~~~~~~~l~~~~~d~~v~vw~v  349 (349)
                      +.|++..+..++.+.++++.+.+|
T Consensus       341 i~Ws~~~~Dwiai~~~kkleiLRV  364 (364)
T KOG0290|consen  341 IQWSSSQPDWIAICFGKKLEILRV  364 (364)
T ss_pred             eeecccCCCEEEEEecCeeeEEeC
Confidence            999998888999999999999876



>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 5e-06
3gfc_A 425 Crystal Structure Of Histone-Binding Protein Rbbp4 1e-05
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-05
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 9e-05
3c99_A 432 Structural Basis Of Histone H4 Recognition By P55 L 8e-04
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 9e-05
2xyi_A 430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 8e-04
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 9e-05
2yba_A 422 Crystal Structure Of Nurf55 In Complex With Histone 8e-04
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-04
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-04
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure

Iteration: 1

Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 54/229 (23%), Positives = 97/229 (42%), Gaps = 25/229 (10%) Query: 134 WNEVDPNLLG---TSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSR 190 WN PNL G ++S D T +W + G+V KT H V D+++ Sbjct: 185 WN---PNLSGHLLSASDDHTICLWDISAVPKEGKVVDA----KTIFTGHTAVVEDVSWHL 237 Query: 191 AGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLR-LAWNKQDPNYLAMVAMN 249 +F SV + + ++D R S + HT + L++N LA + + Sbjct: 238 LH--ESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSAD 295 Query: 250 ACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDI-----QQ 304 V + D+R + +H+ + + W+PH+ + ++G D + +WD+ +Q Sbjct: 296 KT-VALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQ 354 Query: 305 MPRAIED--PILAYTAAG--GEINQIQWGATQPDWIAICYNKYLEVLRV 349 P ED P L + G +I+ W +P W+ IC +++V Sbjct: 355 SPEDAEDGPPELLFIHGGHTAKISDFSWNPNEP-WV-ICSVSEDNIMQV 401
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.98
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.96
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.96
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.95
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.94
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.94
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.94
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.94
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.93
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.93
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.93
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.93
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.92
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.92
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.92
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.92
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.91
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.91
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.9
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.9
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.9
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.89
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.88
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.88
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.87
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.85
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.84
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.84
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.82
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.81
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.8
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.8
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.79
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.79
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.76
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.74
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.74
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.73
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.73
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.72
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.72
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.71
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.7
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.68
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.68
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.67
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.67
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.66
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.66
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.64
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.64
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.64
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.63
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.62
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.61
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.59
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.59
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.59
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.59
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.57
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.56
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.54
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.54
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.53
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.53
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.52
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.5
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.48
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.47
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.45
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.45
2qe8_A343 Uncharacterized protein; structural genomics, join 99.44
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.44
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.41
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.4
2ece_A462 462AA long hypothetical selenium-binding protein; 99.36
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.36
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.35
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.35
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.32
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.31
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.23
2ece_A462 462AA long hypothetical selenium-binding protein; 99.2
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.15
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.11
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.11
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.08
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.06
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.05
2qe8_A343 Uncharacterized protein; structural genomics, join 99.05
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.03
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.03
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.99
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.99
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.97
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.96
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.96
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.93
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.89
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.88
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.86
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.82
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.81
3v65_B386 Low-density lipoprotein receptor-related protein; 98.81
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.8
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.79
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.78
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.78
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.77
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.77
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.72
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.69
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.68
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.67
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.65
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.65
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.63
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.63
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.62
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.62
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.6
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.59
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.54
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.51
3v65_B386 Low-density lipoprotein receptor-related protein; 98.5
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.48
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.45
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.42
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 98.39
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.38
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.37
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.37
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.34
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.34
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.33
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.29
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.26
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.24
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.23
3kya_A496 Putative phosphatase; structural genomics, joint c 98.2
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.16
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.14
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.14
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.13
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.13
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.1
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.09
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.09
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.08
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 98.04
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.04
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.98
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.88
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.78
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.78
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.7
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.69
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.59
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.59
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.56
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.55
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.52
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.5
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.41
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.34
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.31
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.25
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.18
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.1
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.1
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.07
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.9
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.89
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.71
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.56
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.56
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.4
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.32
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.32
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.27
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.27
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.26
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.15
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.14
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.12
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.0
3ott_A 758 Two-component system sensor histidine kinase; beta 95.84
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.57
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.34
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.34
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 94.92
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 94.85
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.63
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.16
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 94.12
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 92.95
3ott_A 758 Two-component system sensor histidine kinase; beta 92.79
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 91.41
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 91.1
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 91.04
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 90.77
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 90.27
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 89.25
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 88.38
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 88.18
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 86.18
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 82.63
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.2e-49  Score=331.87  Aligned_cols=289  Identities=17%  Similarity=0.233  Sum_probs=229.5

Q ss_pred             CceeeEEEeecCCCceEEEEEeeecccCCeEEEEec-----ccc---ccccccceEecCCCCeeEEEEecCCCCCCCcEE
Q psy17688         23 WPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVAL-----NED---ISEFGPKSTIDHPYPTTKIMWIPDRKGVFPDLL   94 (349)
Q Consensus        23 ~~v~~~~~sp~~~~~~~la~g~~~~~~~g~i~i~~~-----~~~---~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~l   94 (349)
                      ..|.+++|+|  ||++ |++++     ++.+++|+.     +..   ...........+...|.+++|+|++.     ++
T Consensus        31 ~~v~~~~fs~--dG~~-l~~~s-----d~~~r~Wd~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~d~~-----l~   97 (344)
T 4gqb_B           31 RQLEAARYRS--DGAL-LLGAS-----SLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERG-----IL   97 (344)
T ss_dssp             SEEEEEEECT--TSCE-EEEEE-----CCSSSCCCEEEEEESSGGGTTCGGGCSEEEEESSCEEEEEEETTTE-----EE
T ss_pred             CCEEEEEECC--CCCE-EEEEe-----CCceEEeeceeeeeccccccCCcceeeeeeccCCCEEEEEEeCCCe-----EE
Confidence            5699999999  9995 77665     445555542     111   01112233456778899999999974     54


Q ss_pred             EEeCC-cEEEEECCCCCchhheeccCCCCCCCcCceeEEEecCCCCCeEEEEEcCCeEEEEeccCcceeeeecccCCcee
Q psy17688         95 ATSGD-YLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVK  173 (349)
Q Consensus        95 ~~~~~-~i~vw~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~~  173 (349)
                      +++.| .|+|||+.+++........   ..+|...|++++|+| ++++|++|+.||.|++||+++++.+           
T Consensus        98 ~~s~dg~v~lWd~~~~~~~~~~~~~---~~~H~~~V~~v~~sp-dg~~l~sgs~d~~i~iwd~~~~~~~-----------  162 (344)
T 4gqb_B           98 VASDSGAVELWELDENETLIVSKFC---KYEHDDIVSTVSVLS-SGTQAVSGSKDICIKVWDLAQQVVL-----------  162 (344)
T ss_dssp             EEETTSEEEEEEECTTSSCEEEEEE---EECCSSCEEEEEECT-TSSEEEEEETTSCEEEEETTTTEEE-----------
T ss_pred             EEECCCEEEEEeccCCCceeEeecc---ccCCCCCEEEEEECC-CCCEEEEEeCCCeEEEEECCCCcEE-----------
Confidence            44446 9999999887533222111   123448999999998 9999999999999999999998887           


Q ss_pred             eeeeccCCceeeEEEecCCCCccEEEEEcCCCcEEEEECCCCCceeeeeeCCCCCceeEEEEeCCCCCeEEEEeeCCcEE
Q psy17688        174 TQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNACEV  253 (349)
Q Consensus       174 ~~~~~~~~~v~~~~~~~~~~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~~~~~d~~~i  253 (349)
                      ..+.+|...|.+++|+|++.  .+|++++.|+.|++||+++++....+....+...+.+++|+|.++.+|++|+.|+ .|
T Consensus       163 ~~~~~h~~~V~~~~~~~~~~--~~l~s~s~D~~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~l~sg~~dg-~v  239 (344)
T 4gqb_B          163 SSYRAHAAQVTCVAASPHKD--SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENG-TV  239 (344)
T ss_dssp             EEECCCSSCEEEEEECSSCT--TEEEEEETTSCEEEEETTSSSCEEECC----CCCEEEEEECSSCTTEEEEEETTS-EE
T ss_pred             EEEcCcCCceEEEEecCCCC--CceeeeccccccccccccccceeeeeecceeeccceeeeecCCCCcceEEeccCC-cE
Confidence            67889999999999999874  6899999999999999999887666554456677999999997788999999999 69


Q ss_pred             EEEeccCCCcceeEeecCCcceEEEEEeeCCCCEEEEEcCCCcEEEEEeecCCCCCCCcEEEEeccCCceEEEEEcCCCC
Q psy17688        254 IILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQIQWGATQP  333 (349)
Q Consensus       254 ~v~d~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~  333 (349)
                      ++||+++ ++++.++.+|...|++++|+|++..+|++|+.|++|+|||++..      .+..+.+|.+.|++++|+|+++
T Consensus       240 ~~wd~~~-~~~~~~~~~h~~~v~~v~fsp~g~~~lasgs~D~~i~vwd~~~~------~~~~~~~H~~~V~~v~~sp~~~  312 (344)
T 4gqb_B          240 SLVDTKS-TSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLS------ELFRSQAHRDFVRDATWSPLNH  312 (344)
T ss_dssp             EEEESCC---CCEEEECCSSCEEEEEECSSSSCCEEEEETTSCEEEECTTCC------EEEEECCCSSCEEEEEECSSST
T ss_pred             EEEECCC-CcEEEEEcCCCCCEEEEEEccCCCeEEEEEeCCCeEEEEECCCC------cEEEEcCCCCCEEEEEEeCCCC
Confidence            9999997 88999999999999999999998644999999999999999773      2456789999999999999988


Q ss_pred             ceE-EEEcCCeEEEeeC
Q psy17688        334 DWI-AICYNKYLEVLRV  349 (349)
Q Consensus       334 ~l~-~~~~d~~v~vw~v  349 (349)
                      .++ +++.|++|++|++
T Consensus       313 ~llas~s~D~~v~~w~v  329 (344)
T 4gqb_B          313 SLLTTVGWDHQVVHHVV  329 (344)
T ss_dssp             TEEEEEETTSCEEEEEC
T ss_pred             eEEEEEcCCCeEEEEEC
Confidence            765 5778999999986



>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 349
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-11
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-04
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 8e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.001
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.003
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 62.4 bits (150), Expect = 1e-11
 Identities = 27/170 (15%), Positives = 53/170 (31%), Gaps = 18/170 (10%)

Query: 132 FDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRVNSVSGHVKTQLIAHDKEVYDIAFSRA 191
                 D  L  + + D +  +W +             G  +     H+ ++  I F   
Sbjct: 189 SLSLAPDTRLFVSGACDASAKLWDVRE-----------GMCRQTFTGHESDINAICFFPN 237

Query: 192 GGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAMVAMNAC 251
           G   + FA+   + + R+FDLR  +       D     +  ++++K     L     +  
Sbjct: 238 G---NAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSK-SGRLLL-AGYDDF 292

Query: 252 EVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWD 301
              + D          L  H   V+ +         + T   D    IW+
Sbjct: 293 NCNVWDALKA-DRAGVLAGHDNRVSCLGVTDDGM-AVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.91
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.9
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.9
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.85
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.81
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.8
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.8
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.78
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.64
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.59
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.58
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.5
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.34
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.34
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.32
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.29
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.24
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.21
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.18
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.15
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.12
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.1
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.06
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.01
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.99
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.9
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.89
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.78
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.53
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.39
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.11
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.86
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.79
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.61
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.58
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.53
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.37
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.14
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.09
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.04
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.98
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.59
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.45
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.13
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.95
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.31
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 94.7
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.59
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.56
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 94.36
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.88
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 93.84
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 93.62
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.54
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 91.21
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 91.11
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 88.54
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 88.05
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 86.3
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 85.55
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 84.01
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 81.7
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.9e-45  Score=307.45  Aligned_cols=293  Identities=16%  Similarity=0.233  Sum_probs=243.6

Q ss_pred             ccccceeeeeecCCceeeEEEeecCCCceEEEEEeeecccCCeEEEEecccccccc--ccceEecCCCCeeEEEEecCCC
Q psy17688         10 PTTQKEIYKYEAPWPLYSMNWSVRPDKLFRLAIGSYVEEYNNKVQIVALNEDISEF--GPKSTIDHPYPTTKIMWIPDRK   87 (349)
Q Consensus        10 ~~~~~~~~~~~~~~~v~~~~~sp~~~~~~~la~g~~~~~~~g~i~i~~~~~~~~~~--~~~~~~~~~~~v~~~~~~~~~~   87 (349)
                      |...+.+..+++..+|++++|+|  +|+| ||+|+     +|.|+||++.......  ......+|.+.|.+++|+|+++
T Consensus        39 p~~~~~~~~~~H~~~V~~v~fs~--~g~~-latg~-----dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~  110 (337)
T d1gxra_          39 PRHARQINTLNHGEVVCAVTISN--PTRH-VYTGG-----KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGC  110 (337)
T ss_dssp             CSEEEEEEEECCSSCCCEEEECS--SSSE-EEEEC-----BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSS
T ss_pred             CCCceEEEECCCCCcEEEEEECC--CCCE-EEEEE-----CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCC
Confidence            45567788888789999999999  9997 99874     6899999997543222  1122236889999999999998


Q ss_pred             CCCCcEEEEeC-C-cEEEEECCCCCchhheeccCCCCCCCcCceeEEEecCCCCCeEEEEEcCCeEEEEeccCcceeeee
Q psy17688         88 GVFPDLLATSG-D-YLRVWRAGEPETRLECILNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWCLETNQVVGRV  165 (349)
Q Consensus        88 ~~~~~~l~~~~-~-~i~vw~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~  165 (349)
                           +|++++ | .|++||+..........+..+.     ..+.++.|+| ++.++++++.|+.|++|++.+++..   
T Consensus       111 -----~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~-----~~v~~~~~~~-~~~~l~s~~~d~~i~~~~~~~~~~~---  176 (337)
T d1gxra_         111 -----TLIVGGEASTLSIWDLAAPTPRIKAELTSSA-----PACYALAISP-DSKVCFSCCSDGNIAVWDLHNQTLV---  176 (337)
T ss_dssp             -----EEEEEESSSEEEEEECCCC--EEEEEEECSS-----SCEEEEEECT-TSSEEEEEETTSCEEEEETTTTEEE---
T ss_pred             -----EEEEeeccccccccccccccccccccccccc-----cccccccccc-ccccccccccccccccccccccccc---
Confidence                 888877 5 9999999876543333344433     6889999998 8999999999999999999988876   


Q ss_pred             cccCCceeeeeeccCCceeeEEEecCCCCccEEEEEcCCCcEEEEECCCCCceeeeeeCCCCCceeEEEEeCCCCCeEEE
Q psy17688        166 NSVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGAEGSVRMFDLRHLEHSTIIYEDPQHTPLLRLAWNKQDPNYLAM  245 (349)
Q Consensus       166 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~~  245 (349)
                              .....|...|.+++|++++   ..+++++.|+.+++||+++++.....   .+..+|.+++|+| ++.+|++
T Consensus       177 --------~~~~~~~~~v~~l~~s~~~---~~~~~~~~d~~v~i~d~~~~~~~~~~---~~~~~i~~l~~~~-~~~~l~~  241 (337)
T d1gxra_         177 --------RQFQGHTDGASCIDISNDG---TKLWTGGLDNTVRSWDLREGRQLQQH---DFTSQIFSLGYCP-TGEWLAV  241 (337)
T ss_dssp             --------EEECCCSSCEEEEEECTTS---SEEEEEETTSEEEEEETTTTEEEEEE---ECSSCEEEEEECT-TSSEEEE
T ss_pred             --------ccccccccccccccccccc---cccccccccccccccccccceeeccc---ccccceEEEEEcc-cccccce
Confidence                    5677899999999999999   89999999999999999987654433   4678999999999 9999999


Q ss_pred             EeeCCcEEEEEeccCCCcceeEeecCCcceEEEEEeeCCCCEEEEEcCCCcEEEEEeecCCCCCCCcEEEEeccCCceEE
Q psy17688        246 VAMNACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAGGEINQ  325 (349)
Q Consensus       246 ~~~d~~~i~v~d~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~~~~~~~v~~  325 (349)
                      ++.|+ .+++||++. .. ......|...|++++|+|++++ |++++.||.|++||+..     .+++..+. |...|.+
T Consensus       242 ~~~d~-~i~i~d~~~-~~-~~~~~~~~~~i~~v~~s~~g~~-l~s~s~Dg~i~iwd~~~-----~~~~~~~~-~~~~v~~  311 (337)
T d1gxra_         242 GMESS-NVEVLHVNK-PD-KYQLHLHESCVLSLKFAYCGKW-FVSTGKDNLLNAWRTPY-----GASIFQSK-ESSSVLS  311 (337)
T ss_dssp             EETTS-CEEEEETTS-SC-EEEECCCSSCEEEEEECTTSSE-EEEEETTSEEEEEETTT-----CCEEEEEE-CSSCEEE
T ss_pred             ecccc-ccccccccc-cc-cccccccccccceEEECCCCCE-EEEEeCCCeEEEEECCC-----CCEEEEcc-CCCCEEE
Confidence            99999 599999986 33 3456778999999999999998 99999999999999987     33455544 5889999


Q ss_pred             EEEcCCCCceEEEEcCCeEEEeeC
Q psy17688        326 IQWGATQPDWIAICYNKYLEVLRV  349 (349)
Q Consensus       326 ~~~~~~~~~l~~~~~d~~v~vw~v  349 (349)
                      ++|+|++++|++++.|++|+||+|
T Consensus       312 ~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         312 CDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             EEECTTSCEEEEEETTSCEEEEEE
T ss_pred             EEEeCCCCEEEEEeCCCeEEEEEE
Confidence            999999999999999999999986



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure