Diaphorina citri psyllid: psy17693


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MILLPGSVRAHVTLLLIALASLIGAEEWMTGDCEHLCKCKWTNGRKGAACNNTGLSAIPRGLSKDVQYLDLGKCNVIFCFPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPDACGLCRSMLFFYFRESTKY
ccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccEEEccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccccc
***LPGSVRAHVTLLLIALASLIGAEEWMTGDCEHLCKCKWTNGRKGAACNNTGLSAIPRGLSKDVQYLDLGKCNVIFCFPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPDACGLCRSMLFFYFREST**
xxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILLPGSVRAHVTLLLIALASLIGAEEWMTGDCEHLCKCKWTNGRKGAACNNTGLSAIPRGLSKDVQYLDLGKCNVIFCFPADAFRSTGLVNLHNLLLKDCNITDIDPDAFSGLGILIELDLTKNRIHTLHPDACGLCRSMLFFYFRESTKY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0005539 [MF]glycosaminoglycan bindingprobableGO:0097367, GO:0003674, GO:0005488
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 39-149
View the alignment between query and template
View the model in PyMOL