Diaphorina citri psyllid: psy176


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MDEKMENNLTWYTSLISISVVVGAVDFESVVYKFKPYLMENQKVWVPDPADGFVLGRILDLGMDEVTVQPLDSKKPKAAFSLDRVYTAEEHDSKDVDDNYS
ccHHHHccEEEEEEEEEEEEEEEEEEccEEEEEECcCECcccEEEECcccccEEEEEEEEEccccEEEEEccccccEEEEccccCCccccccccccccccc
******NNLTWYTSLISISVVVGAVDFESVVYKFKPYLMENQKVWVPDPADGFVLGRILDLGMDEVTVQPLDSKKPKAAFSLDRVYTAE************
xxxxxxxxxxxHxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEKMENNLTWYTSLISISVVVGAVDFESVVYKFKPYLMENQKVWVPDPADGFVLGRILDLGMDEVTVQPLDSKKPKAAFSLDRVYTAEEHDSKDVDDNYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ANJ, chain A
Confidence level:very confident
Coverage over the Query: 41-101
View the alignment between query and template
View the model in PyMOL