Diaphorina citri psyllid: psy17703


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT
ccccccccEEEEEEccccccccccccEEEEEEEEEEEcccccccccccccccEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEcHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccEEEEEEEEEEEEcccHHHHHHHHcccccccEEEEEcccccccccccccccccccCEEEEcccCECccccccccccccccEEEEEEcccccHHHHHHHHHHHccccEEEEccccccccccEEEEEEccccccEEEEccEEEECcccEEEECcccccccccHHHHHHHHcccHHEEEccccEEEEHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHHHHEEEEEEccccEEEEcHHHHHHHccccccccccc
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLY***********ERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDET****MSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREA**********GKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQW**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor MCM4 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.confidentP33991
DNA replication licensing factor MCM4 Acts as component of the Mcm2-7 complex (Mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the Mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation. Essential role in mitotic DNA replication but not in endoreplication.confidentQ26454
DNA replication licensing factor MCM4 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Once loaded onto DNA, double hexamers can slide on dsDNA in the absence of ATPase activity. Required for S phase execution.confidentP30665

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042555 [CC]MCM complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0043138 [MF]3'-5' DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0030174 [BP]regulation of DNA-dependent DNA replication initiationprobableGO:0009889, GO:0051052, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0006275, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0090329, GO:0050789, GO:0080090
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0004003 [MF]ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006268 [BP]DNA unwinding involved in replicationprobableGO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 176-599
View the alignment between query and template
View the model in PyMOL
Template: 3F8T, chain A
Confidence level:very confident
Coverage over the Query: 1-37,55-129,304,344-493,507-600
View the alignment between query and template
View the model in PyMOL
Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 1-158
View the alignment between query and template
View the model in PyMOL
Template: 3F8T, chain A
Confidence level:very confident
Coverage over the Query: 654-716
View the alignment between query and template
View the model in PyMOL