Psyllid ID: psy17703


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT
ccccccccEEEEEEccccccccccccEEEEEEEEEEEcccccccccccccccEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEcHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccEEEEEEEEEEEEcccHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEEEcccEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHccccEEEEccccccccccEEEEEEccccccEEEEccEEEEEcccEEEEEcccccccccHHHHHHHHcccHHEEEccccEEEEHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHHEEEEEEccccEEEEcHHHHHHHccccccccccc
ccccccccEEEEEEEHHHHcccccccEEEEEEEEEEEccccccccccEEEEEccEEEEEEEEEEcccccccccccEEcccHHHHHHHHHHHccccHHHHHHHHHcccHccHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEHHHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHccccEEEEEccccccccHHHccHHHHHHEEEEcEEEEEcccccHHHHEEEEEEcccccEEEEEEcccEEEcccccccccccccEEEEEccccccccEEcccccccccEEEEEEcccccHHHHHHHHHHHHcccEEEEcccccccEEEEEEEEEcccccEEEEEccEEEEccccEEEEccHccccHcHHHHHHHHHHHHHHHHHHHHHHEEEcHHHHHHHHcccccccccccccccccccccccHHccccEEEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHHHHcccEEEEccEEEEEEcccccHcccEEEEEcccEEEEccHccccHcHHHHHHHHHHHHHHHHHHHHHHEEEcHHHHHHHHcccccccccc
mpagqtphsvVLFTYNdlvdsiqpgdrvtvtgiyravplqvnprmrSVKSVYKTHIDVVHFRkidatrlykqdekehkfppERVELLKSlsrkpdiyerltsaicpsiygyedVKKGIMLQmfggtkktfdETISDRMseidlasplnygtpssigslrtprsgiqgtpirlrpdirtdrRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQlvcypqevipildmgvneyfferhpaavlehqiqvrpfnakktrnlrhlnpedidQLITINGMVIRTSNIIPEMREAFFRCIVCnysttveidrgriheptlctncstnhcfslvhnrshftdKQLVRLqetpaeinillcgdpgtsksQLLSYVYDlvprsqytsgkgssavgltayitkdpeTRQMVLQTGALVLadsgvccidefdkmsDTTRSILHEVMEQQTLSIAKAGIICQLNARTSIlaaanpcdsqwntsktiidnirlphtllSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQehlsptlseEASQRLIQTYVDMRKlgagrgrisaYPRQLESLIRLSEAHAKMRysetvevqDVDEAWRLHREALKqsatdplsgkidvsilTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLAdsgvccidefdkmsDTTRSILHEVMEQQTLSIAKAGIICQLNARTSIlaaanpcdsqwnt
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIyravplqvnprmrsvKSVYkthidvvhfrkidatrlykqdekehkfppervellkslsrkpdiyerltsaicpsiyGYEDVKKGIMLQMFGGTKKTFDETISDRMSEidlasplnygtpssigslrtprsgiqgtpirlrpdirtDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSqytsgkgssavgLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEhlsptlseeaSQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREAlkqsatdplsgkidVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILaaanpcdsqwnt
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTllsrfdlifllldPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT
********SVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYK*********************KPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDET************************************IRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGD*****************************VGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPT******QRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREA**********GKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAA*********
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRA****************KTHIDVVHFRK******************ERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGT***********MSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSH**********ETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYV*************AYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREA*************************************************VTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQW**
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT
****QTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLY**DEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAGQTPHSVVLFTYNDLVDSIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDEKEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSSIGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHLDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVILLGPSVTVTQQKLIMDLKGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query720 2.2.26 [Sep-21-2011]
Q26454866 DNA replication licensing yes N/A 0.431 0.359 0.752 1e-141
Q6GL41863 DNA replication licensing yes N/A 0.469 0.391 0.652 1e-133
Q5XK83858 DNA replication licensing N/A N/A 0.469 0.393 0.649 1e-133
P30664863 DNA replication licensing N/A N/A 0.433 0.361 0.698 1e-132
P33991863 DNA replication licensing yes N/A 0.433 0.361 0.701 1e-132
P49717862 DNA replication licensing yes N/A 0.433 0.361 0.692 1e-131
P30665933 DNA replication licensing yes N/A 0.412 0.318 0.548 1e-92
P29458931 DNA replication licensing yes N/A 0.373 0.288 0.570 2e-88
Q9UXG1686 Minichromosome maintenanc yes N/A 0.405 0.425 0.431 4e-66
Q6NX31720 DNA replication licensing no N/A 0.341 0.341 0.513 5e-65
>sp|Q26454|MCM4_DROME DNA replication licensing factor MCM4 OS=Drosophila melanogaster GN=dpa PE=1 SV=2 Back     alignment and function desciption
 Score =  502 bits (1293), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/327 (75%), Positives = 283/327 (86%), Gaps = 16/327 (4%)

Query: 344 AEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTG 403
           +EI++LLCGDPGTSKSQ+L YV++LVPRSQYTSG+GSSAVGLTAY+TKDPETRQ+VLQTG
Sbjct: 504 SEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTG 563

Query: 404 ALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCD 463
           ALVLAD+GVCCIDEFDKM+D+TRS+LHEVMEQQTLSIAKAGIICQLNARTSILAAANP +
Sbjct: 564 ALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAE 623

Query: 464 SQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHL--------------- 508
           SQWN  K IIDN++LPHTLLSRFDLIFL+LDPQ E FD RLA HL               
Sbjct: 624 SQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTM 683

Query: 509 -DITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLS 567
            D++VLRDYIAYA+EHLSPTLS+EA QRLIQ YVDMRK+GAGRG+ISAYPRQLESLIRLS
Sbjct: 684 FDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLS 743

Query: 568 EAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLEL 627
           EAHAK+R S  VE+ DV+EAWRLHREALKQSATDPLSGKIDV ILTTG+S+AAR+++ +L
Sbjct: 744 EAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADL 803

Query: 628 TAALKKLVILLGPSVTVTQQKLIMDLK 654
            AA+K+ +   G  +TV  QKL  D+K
Sbjct: 804 VAAIKENLKKKGKVLTVPYQKLFSDIK 830




Acts as component of the Mcm2-7 complex (Mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the Mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation. Essential role in mitotic DNA replication but not in endoreplication.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q6GL41|MCM4_XENTR DNA replication licensing factor mcm4 OS=Xenopus tropicalis GN=mcm4 PE=2 SV=1 Back     alignment and function description
>sp|Q5XK83|MCM4A_XENLA DNA replication licensing factor mcm4-A OS=Xenopus laevis GN=mcm4-a PE=1 SV=1 Back     alignment and function description
>sp|P30664|MCM4B_XENLA DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-b PE=1 SV=3 Back     alignment and function description
>sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5 Back     alignment and function description
>sp|P49717|MCM4_MOUSE DNA replication licensing factor MCM4 OS=Mus musculus GN=Mcm4 PE=2 SV=1 Back     alignment and function description
>sp|P30665|MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM4 PE=1 SV=2 Back     alignment and function description
>sp|P29458|MCM4_SCHPO DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm4 PE=1 SV=2 Back     alignment and function description
>sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 Back     alignment and function description
>sp|Q6NX31|MCM7_XENTR DNA replication licensing factor mcm7 OS=Xenopus tropicalis GN=mcm7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
189238875 883 PREDICTED: similar to DNA replication li 0.438 0.357 0.741 1e-141
195121564 863 GI20404 [Drosophila mojavensis] gi|19391 0.431 0.360 0.755 1e-140
195425383 871 GK10701 [Drosophila willistoni] gi|19415 0.438 0.362 0.747 1e-140
195383940 864 GJ20076 [Drosophila virilis] gi|19414548 0.431 0.359 0.755 1e-140
194757594 865 GF13675 [Drosophila ananassae] gi|190622 0.438 0.365 0.747 1e-140
194863800 866 GG10740 [Drosophila erecta] gi|190662487 0.431 0.359 0.755 1e-140
195474398 866 GE23926 [Drosophila yakuba] gi|194175579 0.431 0.359 0.755 1e-139
195029713 863 GH19815 [Drosophila grimshawi] gi|193903 0.438 0.366 0.744 1e-139
195332135 866 GM20786 [Drosophila sechellia] gi|194124 0.431 0.359 0.752 1e-139
17137242 866 disc proliferation abnormal [Drosophila 0.431 0.359 0.752 1e-139
>gi|189238875|ref|XP_973671.2| PREDICTED: similar to DNA replication licensing factor MCM4 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  508 bits (1309), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/333 (74%), Positives = 292/333 (87%), Gaps = 17/333 (5%)

Query: 344 AEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTG 403
           +EINILLCGDPGTSKSQLL YVY+LVPRSQYTSGKGSSAVGLTAY+TKD ETRQ+VLQTG
Sbjct: 517 SEINILLCGDPGTSKSQLLQYVYNLVPRSQYTSGKGSSAVGLTAYVTKDTETRQLVLQTG 576

Query: 404 ALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCD 463
           ALVLAD+G+CCIDEFDKM+D+TRS+LHEVMEQQTLSIAKAGIICQLNARTSILAAANP +
Sbjct: 577 ALVLADNGICCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPSE 636

Query: 464 SQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARH---------------- 507
           SQWN +KTII+N++LPHTLLSRFDLIFL+LDPQSE FD +LA H                
Sbjct: 637 SQWNKNKTIIENVQLPHTLLSRFDLIFLILDPQSELFDRKLASHLVSLYHKAPQQNDDEI 696

Query: 508 LDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLS 567
           LD+++LRDY+AYA+EH+ P LSEEASQRLIQ YVDMRK+G+GRG+ISAYPRQLESLIRLS
Sbjct: 697 LDMSILRDYLAYAKEHIHPKLSEEASQRLIQAYVDMRKVGSGRGQISAYPRQLESLIRLS 756

Query: 568 EAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLEL 627
           EAHAK+R+S+ V+V+DV+EAWRLHREALKQSATDPLSGKIDV ILTTG+S+AAR+R++EL
Sbjct: 757 EAHAKVRFSQVVQVEDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSNAARKRRVEL 816

Query: 628 TAALKKLVILLGPSVTVTQQKLIMDLK-GALVL 659
             A+KKL+   G   T+  QKL+ +++ G+ V+
Sbjct: 817 AQAMKKLIESKGKVPTINYQKLLAEMREGSSVM 849




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195121564|ref|XP_002005290.1| GI20404 [Drosophila mojavensis] gi|193910358|gb|EDW09225.1| GI20404 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195425383|ref|XP_002060989.1| GK10701 [Drosophila willistoni] gi|194157074|gb|EDW71975.1| GK10701 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195383940|ref|XP_002050683.1| GJ20076 [Drosophila virilis] gi|194145480|gb|EDW61876.1| GJ20076 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194757594|ref|XP_001961049.1| GF13675 [Drosophila ananassae] gi|190622347|gb|EDV37871.1| GF13675 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|194863800|ref|XP_001970620.1| GG10740 [Drosophila erecta] gi|190662487|gb|EDV59679.1| GG10740 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195474398|ref|XP_002089478.1| GE23926 [Drosophila yakuba] gi|194175579|gb|EDW89190.1| GE23926 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195029713|ref|XP_001987716.1| GH19815 [Drosophila grimshawi] gi|193903716|gb|EDW02583.1| GH19815 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195332135|ref|XP_002032754.1| GM20786 [Drosophila sechellia] gi|194124724|gb|EDW46767.1| GM20786 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|17137242|ref|NP_477185.1| disc proliferation abnormal [Drosophila melanogaster] gi|17380470|sp|Q26454.2|MCM4_DROME RecName: Full=DNA replication licensing factor MCM4; AltName: Full=Protein disc proliferation abnormal gi|7304207|gb|AAF59242.1| disc proliferation abnormal [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
FB|FBgn0015929866 dpa "disc proliferation abnorm 0.437 0.363 0.709 7.7e-208
UNIPROTKB|E1C2U4859 MCM4 "Uncharacterized protein" 0.431 0.362 0.678 5.4e-184
ZFIN|ZDB-GENE-030131-9544845 mcm4 "MCM4 minichromosome main 0.433 0.369 0.670 3.8e-181
UNIPROTKB|G3V681862 Mcm4 "RCG36531, isoform CRA_b" 0.433 0.361 0.655 1.3e-176
UNIPROTKB|Q6GL41863 mcm4 "DNA replication licensin 0.451 0.376 0.646 3e-170
UNIPROTKB|P30664863 mcm4-b "DNA replication licens 0.451 0.376 0.640 1e-169
UNIPROTKB|F1RSE7836 MCM4 "Uncharacterized protein" 0.433 0.373 0.664 1.2e-169
UNIPROTKB|Q5XK83858 mcm4-a "DNA replication licens 0.451 0.378 0.643 2.1e-169
UNIPROTKB|E2QSM6866 MCM4 "Uncharacterized protein" 0.433 0.360 0.661 1.3e-167
UNIPROTKB|F6V1U9863 MCM4 "Uncharacterized protein" 0.433 0.361 0.661 1.3e-167
FB|FBgn0015929 dpa "disc proliferation abnormal" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1161 (413.8 bits), Expect = 7.7e-208, Sum P(3) = 7.7e-208
 Identities = 235/331 (70%), Positives = 271/331 (81%)

Query:   340 QETPAEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMV 399
             Q   +EI++LLCGDPGTSKSQ+L YV++LVPRSQYTSG+GSSAVGLTAY+TKDPETRQ+V
Sbjct:   500 QNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLV 559

Query:   400 LQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAA 459
             LQTGALVLAD+GVCCIDEFDKM+D+TRS+LHEVMEQQTLSIAKAGIICQLNARTSILAAA
Sbjct:   560 LQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAA 619

Query:   460 NPCDSQWNTSKTIIDNIRLPHTXXXXXXXXXXXXXPQSEQFDARLARHL----------- 508
             NP +SQWN  K IIDN++LPHT             PQ E FD RLA HL           
Sbjct:   620 NPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEE 679

Query:   509 -----DITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESL 563
                  D++VLRDYIAYA+EHLSPTLS+EA QRLIQ YVDMRK+GAGRG+ISAYPRQLESL
Sbjct:   680 EDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESL 739

Query:   564 IRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQR 623
             IRLSEAHAK+R S  VE+ DV+EAWRLHREALKQSATDPLSGKIDV ILTTG+S+AAR++
Sbjct:   740 IRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKK 799

Query:   624 QLELTAALKKLVILLGPSVTVTQQKLIMDLK 654
             + +L AA+K+ +   G  +TV  QKL  D+K
Sbjct:   800 RADLVAAIKENLKKKGKVLTVPYQKLFSDIK 830


GO:0006260 "DNA replication" evidence=ISS;IMP;NAS;TAS
GO:0042023 "DNA endoreduplication" evidence=NAS
GO:0003677 "DNA binding" evidence=IEA;NAS
GO:0005634 "nucleus" evidence=NAS
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0006270 "DNA replication initiation" evidence=IEA
GO:0042555 "MCM complex" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0043138 "3'-5' DNA helicase activity" evidence=IDA
UNIPROTKB|E1C2U4 MCM4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9544 mcm4 "MCM4 minichromosome maintenance deficient 4, mitotin (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3V681 Mcm4 "RCG36531, isoform CRA_b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GL41 mcm4 "DNA replication licensing factor mcm4" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|P30664 mcm4-b "DNA replication licensing factor mcm4-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSE7 MCM4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XK83 mcm4-a "DNA replication licensing factor mcm4-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSM6 MCM4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6V1U9 MCM4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33991MCM4_HUMAN3, ., 6, ., 4, ., 1, 20.70120.43330.3615yesN/A
Q26454MCM4_DROME3, ., 6, ., 4, ., 1, 20.75220.43190.3591yesN/A
P49717MCM4_MOUSE3, ., 6, ., 4, ., 1, 20.69200.43330.3619yesN/A
P30665MCM4_YEAST3, ., 6, ., 4, ., 1, 20.54850.41250.3183yesN/A
Q6GL41MCM4_XENTR3, ., 6, ., 4, ., 1, 20.65200.46940.3916yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
pfam00493327 pfam00493, MCM, MCM2/3/5 family 1e-142
smart00350509 smart00350, MCM, minichromosome maintenance protei 1e-135
COG1241682 COG1241, MCM2, Predicted ATPase involved in replic 1e-118
PTZ00111915 PTZ00111, PTZ00111, DNA replication licensing fact 2e-80
smart00350509 smart00350, MCM, minichromosome maintenance protei 2e-39
pfam00493 327 pfam00493, MCM, MCM2/3/5 family 9e-38
smart00350 509 smart00350, MCM, minichromosome maintenance protei 4e-35
COG1241682 COG1241, MCM2, Predicted ATPase involved in replic 7e-34
COG1241 682 COG1241, MCM2, Predicted ATPase involved in replic 2e-27
COG1241 682 COG1241, MCM2, Predicted ATPase involved in replic 2e-27
PTZ00111915 PTZ00111, PTZ00111, DNA replication licensing fact 6e-26
smart00350509 smart00350, MCM, minichromosome maintenance protei 1e-25
PTZ00111 915 PTZ00111, PTZ00111, DNA replication licensing fact 5e-24
PTZ00111 915 PTZ00111, PTZ00111, DNA replication licensing fact 4e-19
pfam00493327 pfam00493, MCM, MCM2/3/5 family 7e-16
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 6e-11
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 1e-05
COG1239423 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme 7e-05
TIGR02031 589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 1e-04
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
 Score =  418 bits (1076), Expect = e-142
 Identities = 151/271 (55%), Positives = 191/271 (70%), Gaps = 19/271 (7%)

Query: 345 EINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGA 404
           +IN+LL GDPGT+KSQLL YV  L PR+ YTSGKGSSA GLTA + +DP+T +  L+ GA
Sbjct: 57  DINVLLVGDPGTAKSQLLKYVAKLAPRAVYTSGKGSSAAGLTAAVVRDPDTGEWTLEAGA 116

Query: 405 LVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDS 464
           LVLAD GVCCIDEFDKM++  R  +HE MEQQT+SIAKAGI+  LNAR S+LAAANP   
Sbjct: 117 LVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVATLNARCSVLAAANPIFG 176

Query: 465 QWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARH----------------- 507
           +++  K++ +NI LP  LLSRFDLIF+LLD   E+ D  LA+H                 
Sbjct: 177 RYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEERDEELAKHIVDLHRASDEEEIETED 236

Query: 508 -LDITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLG-AGRGRISAYPRQLESLIR 565
            +D  +LR YIAYA+E++ P LS+EA ++L+  YV++RK     RG I    RQLESLIR
Sbjct: 237 EIDPELLRKYIAYARENIKPKLSDEAREKLVNWYVELRKESEGSRGSIPITVRQLESLIR 296

Query: 566 LSEAHAKMRYSETVEVQDVDEAWRLHREALK 596
           LSEAHA++R SE V  +DV+EA RL  E+LK
Sbjct: 297 LSEAHARLRLSEEVTEEDVEEAIRLILESLK 327


Length = 327

>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|224160 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 720
KOG0478|consensus804 100.0
COG1241682 MCM2 Predicted ATPase involved in replication cont 100.0
KOG0482|consensus721 100.0
KOG0481|consensus729 100.0
KOG0480|consensus764 100.0
PTZ00111915 DNA replication licensing factor MCM4; Provisional 100.0
KOG0479|consensus818 100.0
KOG0477|consensus854 100.0
smart00350509 MCM minichromosome maintenance proteins. 100.0
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 100.0
KOG0482|consensus 721 100.0
KOG0481|consensus 729 100.0
COG1241 682 MCM2 Predicted ATPase involved in replication cont 100.0
KOG0477|consensus 854 100.0
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 100.0
KOG0478|consensus804 100.0
KOG0479|consensus 818 100.0
KOG0480|consensus764 99.95
smart00350509 MCM minichromosome maintenance proteins. 99.95
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.92
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.92
PRK09862506 putative ATP-dependent protease; Provisional 99.92
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.9
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.9
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.89
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.89
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.88
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.88
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.85
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.83
PRK13531498 regulatory ATPase RavA; Provisional 99.79
COG0714329 MoxR-like ATPases [General function prediction onl 99.76
PF07726131 AAA_3: ATPase family associated with various cellu 99.76
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.73
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.7
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.69
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.66
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.66
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.57
PF00493 331 MCM: MCM2/3/5 family This family extends the MCM d 99.56
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.55
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.54
PHA02244383 ATPase-like protein 99.53
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.52
COG2204464 AtoC Response regulator containing CheY-like recei 99.5
PRK13765 637 ATP-dependent protease Lon; Provisional 99.49
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.44
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.44
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.41
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.41
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.4
KOG0734|consensus752 99.4
PF14551121 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1 99.38
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.36
COG1221403 PspF Transcriptional regulators containing an AAA- 99.36
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.36
PRK11608326 pspF phage shock protein operon transcriptional ac 99.34
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.34
CHL00181287 cbbX CbbX; Provisional 99.34
PRK15424538 propionate catabolism operon regulatory protein Pr 99.32
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.32
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.32
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.31
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.31
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.29
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.29
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.28
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.26
PLN03025319 replication factor C subunit; Provisional 99.26
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.26
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.22
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.21
PRK03992389 proteasome-activating nucleotidase; Provisional 99.19
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.19
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.18
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.17
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.16
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.15
CHL00195489 ycf46 Ycf46; Provisional 99.14
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.14
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.13
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.12
KOG2004|consensus 906 99.11
PRK15115444 response regulator GlrR; Provisional 99.11
KOG2028|consensus554 99.11
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.11
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.1
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.09
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.09
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.08
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.08
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.08
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.07
KOG0989|consensus346 99.06
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.06
CHL00176638 ftsH cell division protein; Validated 99.05
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.05
PRK13342413 recombination factor protein RarA; Reviewed 99.05
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.03
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.02
CHL00095821 clpC Clp protease ATP binding subunit 99.02
KOG0738|consensus491 99.02
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.01
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.01
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 99.0
KOG0990|consensus360 98.99
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.99
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.97
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.96
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.96
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.96
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.95
KOG0730|consensus693 98.95
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.95
PRK13341 725 recombination factor protein RarA/unknown domain f 98.95
CHL00206 2281 ycf2 Ycf2; Provisional 98.95
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.93
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.93
KOG0742|consensus630 98.93
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.93
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.92
PF00004132 AAA: ATPase family associated with various cellula 98.9
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.89
KOG0745|consensus564 98.88
PRK10865857 protein disaggregation chaperone; Provisional 98.88
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.84
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.84
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.83
KOG0652|consensus424 98.83
CHL00095 821 clpC Clp protease ATP binding subunit 98.83
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.83
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.82
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.82
KOG0737|consensus386 98.81
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.81
KOG0736|consensus953 98.81
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.8
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.8
KOG0731|consensus774 98.8
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 98.78
PRK08084235 DNA replication initiation factor; Provisional 98.77
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.76
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.76
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.76
KOG1942|consensus456 98.76
KOG0733|consensus 802 98.76
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.76
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.75
PRK12402337 replication factor C small subunit 2; Reviewed 98.75
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.75
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.74
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.74
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.74
PRK10865 857 protein disaggregation chaperone; Provisional 98.74
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.73
PRK06620214 hypothetical protein; Validated 98.72
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.72
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.71
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 98.71
PRK00440319 rfc replication factor C small subunit; Reviewed 98.68
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.68
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.68
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.68
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.67
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.65
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.65
PRK06893229 DNA replication initiation factor; Validated 98.63
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.62
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.62
KOG0739|consensus439 98.61
PRK08727233 hypothetical protein; Validated 98.6
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 98.59
KOG0728|consensus404 98.58
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.57
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.57
KOG0733|consensus802 98.57
PRK09087226 hypothetical protein; Validated 98.57
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.56
KOG0991|consensus333 98.56
PTZ001121164 origin recognition complex 1 protein; Provisional 98.56
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.54
PHA02544316 44 clamp loader, small subunit; Provisional 98.53
PRK04132846 replication factor C small subunit; Provisional 98.53
KOG0727|consensus408 98.52
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.52
PRK12422445 chromosomal replication initiation protein; Provis 98.5
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 98.49
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.48
PRK00149450 dnaA chromosomal replication initiation protein; R 98.48
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.47
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.46
PRK14087450 dnaA chromosomal replication initiation protein; P 98.45
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.44
PRK04195 482 replication factor C large subunit; Provisional 98.44
PRK11823446 DNA repair protein RadA; Provisional 98.44
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.42
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.4
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.4
KOG0726|consensus440 98.4
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.39
PRK14086617 dnaA chromosomal replication initiation protein; P 98.39
KOG0743|consensus457 98.36
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.33
PRK07940394 DNA polymerase III subunit delta'; Validated 98.33
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.33
PRK05642234 DNA replication initiation factor; Validated 98.31
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.31
PRK05707328 DNA polymerase III subunit delta'; Validated 98.29
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.28
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 98.27
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.25
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.25
KOG0744|consensus423 98.24
KOG0729|consensus435 98.24
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.23
smart00382148 AAA ATPases associated with a variety of cellular 98.22
PRK14088440 dnaA chromosomal replication initiation protein; P 98.22
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.21
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 98.17
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.15
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.13
PHA01747425 putative ATP-dependent protease 98.07
PRK08058329 DNA polymerase III subunit delta'; Validated 98.06
COG0593408 DnaA ATPase involved in DNA replication initiation 98.05
KOG0735|consensus952 98.03
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.01
KOG0651|consensus388 97.99
PRK06964342 DNA polymerase III subunit delta'; Validated 97.98
KOG0740|consensus428 97.96
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.91
KOG0730|consensus 693 97.87
PRK06871325 DNA polymerase III subunit delta'; Validated 97.87
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.87
PRK07993334 DNA polymerase III subunit delta'; Validated 97.84
KOG1808|consensus 1856 97.79
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.79
PRK05564313 DNA polymerase III subunit delta'; Validated 97.79
PF13337457 Lon_2: Putative ATP-dependent Lon protease 97.75
KOG0732|consensus 1080 97.75
KOG0741|consensus 744 97.73
KOG1051|consensus898 97.66
PRK09112351 DNA polymerase III subunit delta'; Validated 97.65
PRK07471365 DNA polymerase III subunit delta'; Validated 97.63
PRK08769319 DNA polymerase III subunit delta'; Validated 97.58
PRK06921266 hypothetical protein; Provisional 97.55
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.5
PRK08699325 DNA polymerase III subunit delta'; Validated 97.5
KOG0736|consensus 953 97.45
PRK12377248 putative replication protein; Provisional 97.44
PRK15455644 PrkA family serine protein kinase; Provisional 97.44
PRK07399314 DNA polymerase III subunit delta'; Validated 97.39
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.36
PRK06090319 DNA polymerase III subunit delta'; Validated 97.34
KOG2680|consensus454 97.3
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.3
KOG2035|consensus351 97.25
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 97.23
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 97.22
PRK09862 506 putative ATP-dependent protease; Provisional 97.18
PRK08181269 transposase; Validated 97.15
PRK08116268 hypothetical protein; Validated 97.15
KOG1514|consensus767 97.07
PRK06526254 transposase; Provisional 97.05
KOG1969|consensus 877 97.02
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.99
PRK09183259 transposase/IS protein; Provisional 96.99
PF13148378 DUF3987: Protein of unknown function (DUF3987) 96.98
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 96.96
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.92
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.87
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 96.81
PRK06835329 DNA replication protein DnaC; Validated 96.78
PRK07952244 DNA replication protein DnaC; Validated 96.72
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 96.7
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.67
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.67
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.66
PHA02774613 E1; Provisional 96.64
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.55
PHA02624647 large T antigen; Provisional 96.52
PRK05917290 DNA polymerase III subunit delta'; Validated 96.46
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 96.28
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 96.26
KOG2545|consensus543 96.23
KOG0735|consensus 952 96.19
PRK07132299 DNA polymerase III subunit delta'; Validated 96.16
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.15
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.13
PRK05818261 DNA polymerase III subunit delta'; Validated 96.11
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 96.01
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 96.01
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 95.93
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 95.77
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 95.62
PF13173128 AAA_14: AAA domain 95.47
PF1333596 Mg_chelatase_2: Magnesium chelatase, subunit ChlI 95.44
PRK04296190 thymidine kinase; Provisional 95.42
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 95.42
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.42
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 95.39
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.36
PRK04040188 adenylate kinase; Provisional 95.29
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 95.26
PRK07276290 DNA polymerase III subunit delta'; Validated 95.19
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.12
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.06
KOG3347|consensus176 94.88
PHA00729226 NTP-binding motif containing protein 94.83
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.78
COG4178604 ABC-type uncharacterized transport system, permeas 94.73
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 94.71
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.66
PRK14532188 adenylate kinase; Provisional 94.64
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.56
KOG2170|consensus344 94.49
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 94.47
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.35
PRK13947171 shikimate kinase; Provisional 94.34
PRK08118167 topology modulation protein; Reviewed 94.33
PRK00131175 aroK shikimate kinase; Reviewed 94.16
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.12
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.01
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.9
PRK03839180 putative kinase; Provisional 93.88
PRK14530215 adenylate kinase; Provisional 93.81
PF1324576 AAA_19: Part of AAA domain 93.77
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 93.74
PRK00625173 shikimate kinase; Provisional 93.68
KOG3595|consensus 1395 93.67
PRK06581263 DNA polymerase III subunit delta'; Validated 93.57
PRK07261171 topology modulation protein; Provisional 93.55
PRK13949169 shikimate kinase; Provisional 93.49
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 93.49
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.43
PRK06762166 hypothetical protein; Provisional 93.43
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.28
PRK14531183 adenylate kinase; Provisional 93.26
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.17
PF05729166 NACHT: NACHT domain 93.08
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.08
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.07
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.05
PF07726131 AAA_3: ATPase family associated with various cellu 93.04
PRK14526211 adenylate kinase; Provisional 92.88
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 92.85
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 92.81
PRK08233182 hypothetical protein; Provisional 92.79
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.76
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.68
PRK14528186 adenylate kinase; Provisional 92.65
PTZ00088229 adenylate kinase 1; Provisional 92.64
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 92.63
PRK08939306 primosomal protein DnaI; Reviewed 92.63
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 92.56
PRK06217183 hypothetical protein; Validated 92.51
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.45
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 92.41
PRK05057172 aroK shikimate kinase I; Reviewed 92.29
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 92.27
PRK02496184 adk adenylate kinase; Provisional 92.19
COG4619223 ABC-type uncharacterized transport system, ATPase 92.18
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 92.13
PHA02530300 pseT polynucleotide kinase; Provisional 92.11
PRK14527191 adenylate kinase; Provisional 92.08
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 92.07
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 92.05
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 92.04
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 92.01
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.93
PF1355562 AAA_29: P-loop containing region of AAA domain 91.9
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.88
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 91.87
PRK00279215 adk adenylate kinase; Reviewed 91.87
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 91.83
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 91.81
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.7
PLN02200234 adenylate kinase family protein 91.7
PLN02348395 phosphoribulokinase 91.67
KOG2227|consensus529 91.63
PRK13851344 type IV secretion system protein VirB11; Provision 91.6
PTZ00301210 uridine kinase; Provisional 91.52
PRK14529223 adenylate kinase; Provisional 91.51
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 91.49
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 91.44
COG0703172 AroK Shikimate kinase [Amino acid transport and me 91.44
COG1485367 Predicted ATPase [General function prediction only 91.31
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 91.31
cd01124187 KaiC KaiC is a circadian clock protein primarily f 91.3
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 91.2
PRK00300205 gmk guanylate kinase; Provisional 91.19
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 91.16
PRK03731171 aroL shikimate kinase II; Reviewed 91.02
COG1936180 Predicted nucleotide kinase (related to CMP and AM 90.94
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 90.82
PRK13948182 shikimate kinase; Provisional 90.7
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 90.69
COG4088261 Predicted nucleotide kinase [Nucleotide transport 90.68
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 90.68
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 90.67
KOG2383|consensus467 90.62
PLN02674244 adenylate kinase 90.55
PRK05541176 adenylylsulfate kinase; Provisional 90.53
PRK13946184 shikimate kinase; Provisional 90.5
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 90.48
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 90.45
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 90.43
TIGR00235207 udk uridine kinase. Model contains a number of lon 90.37
cd00154159 Rab Rab family. Rab GTPases form the largest famil 90.3
PRK03846198 adenylylsulfate kinase; Provisional 90.27
TIGR00231161 small_GTP small GTP-binding protein domain. This m 90.26
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 90.25
cd01878204 HflX HflX subfamily. A distinct conserved domain w 90.23
PLN02459261 probable adenylate kinase 90.22
PF13479213 AAA_24: AAA domain 90.2
PF00005137 ABC_tran: ABC transporter This structure is on hol 90.09
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 89.99
KOG0060|consensus659 89.92
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 89.91
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 89.9
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 89.89
PRK12339197 2-phosphoglycerate kinase; Provisional 89.83
PRK14737186 gmk guanylate kinase; Provisional 89.81
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 89.73
COG0606 490 Predicted ATPase with chaperone activity [Posttran 89.71
PRK09825176 idnK D-gluconate kinase; Provisional 89.71
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 89.68
PRK00889175 adenylylsulfate kinase; Provisional 89.67
COG1136226 SalX ABC-type antimicrobial peptide transport syst 89.64
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 89.63
PRK05480209 uridine/cytidine kinase; Provisional 89.48
PRK06547172 hypothetical protein; Provisional 89.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 89.42
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 89.42
PLN02165334 adenylate isopentenyltransferase 89.4
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 89.35
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 89.33
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 89.32
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 89.32
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 89.31
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 89.23
COG4098441 comFA Superfamily II DNA/RNA helicase required for 89.22
PRK04182180 cytidylate kinase; Provisional 89.17
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 89.12
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 89.11
PRK01184184 hypothetical protein; Provisional 89.09
PRK14738206 gmk guanylate kinase; Provisional 89.08
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 89.06
cd00876160 Ras Ras family. The Ras family of the Ras superfam 89.04
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 89.02
PLN02318 656 phosphoribulokinase/uridine kinase 88.98
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 88.94
PRK13833323 conjugal transfer protein TrbB; Provisional 88.93
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 88.93
TIGR02237209 recomb_radB DNA repair and recombination protein R 88.93
PRK13695174 putative NTPase; Provisional 88.9
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 88.88
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 88.87
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 88.83
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 88.74
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 88.74
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 88.64
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 88.57
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 88.56
PRK13826 1102 Dtr system oriT relaxase; Provisional 88.47
PRK13975196 thymidylate kinase; Provisional 88.43
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 88.42
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 88.37
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 88.36
PRK08356195 hypothetical protein; Provisional 88.29
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 88.2
KOG1970|consensus 634 88.19
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 88.16
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 88.14
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 88.13
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 88.13
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 88.06
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 88.06
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 88.05
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 88.05
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 88.03
cd03269210 ABC_putative_ATPase This subfamily is involved in 87.99
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 87.96
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 87.91
cd03216163 ABC_Carb_Monos_I This family represents the domain 87.89
PF01057271 Parvo_NS1: Parvovirus non-structural protein NS1; 87.86
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 87.8
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 87.76
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 87.73
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 87.7
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 87.67
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 87.66
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 87.65
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 87.63
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 87.61
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 87.57
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 87.54
cd03246173 ABCC_Protease_Secretion This family represents the 87.54
PRK13808333 adenylate kinase; Provisional 87.53
PRK13889 988 conjugal transfer relaxase TraA; Provisional 87.51
>KOG0478|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-96  Score=802.76  Aligned_cols=460  Identities=64%  Similarity=0.970  Sum_probs=447.6

Q ss_pred             hhHHHHHHHhcCCcEEEEechhHhhhcHHHHHHHHhChhhHHHHHHHHHHHHHHhhCcccccccceEEEecCCccccccc
Q psy17703        178 TDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKKTRNLR  257 (720)
Q Consensus       178 ~~~~~r~~~~~~~~~l~id~~~l~~~d~~L~~~l~~~P~~~i~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r  257 (720)
                      |.+.+++|...+...+++|..||+.||.+||++++.||+|+++.|+.++++++.+.++.....+.++||++|..++.++|
T Consensus       154 yi~~l~e~~~~~~~~ln~~~~hl~~~~~~Ly~ql~~ypqevip~~d~t~~~~~~e~~~~~~~~~~i~vRPfn~~~~~smr  233 (804)
T KOG0478|consen  154 YIKSLLELKELEPEFLNLDAEHLTDFDMDLYRQLVVYPQEVIPIFDETANEIVLERYVLEILEKSIKVRPFNAGKTFSMR  233 (804)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhccccccHHHHHhhhhchHhhcccchHHHHHHHHhhccccchhceeEeeccCcccccccc
Confidence            66779999999999999999999999999999999999999999999999999999988888899999999999999999


Q ss_pred             cCCCcCCCceEEEeeEEEEecccchhhhhheeecccCCceeeeeeccCcccCCccCCCCCCCCcceeeccCCccchhhhh
Q psy17703        258 HLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCTNCSTNHCFSLVHNRSHFTDKQLV  337 (720)
Q Consensus       258 ~l~~~~i~~lv~v~Giv~r~s~v~p~~~~~~f~C~~Cg~~~~~~~~~~~~~~p~~C~~C~~~~~~~~~~~~s~~~d~Q~i  337 (720)
                      +|+|++|+|||+++|+|+|+|++.|+|+.++|+|..|++++.+++.+|++.+|..|++|+..+.|.+.|++|.|.|+|.+
T Consensus       234 ~lNp~dIDkLisI~GmViRss~vipem~~afFrC~vC~~~~~ve~drg~i~eP~~C~~C~~~~~~~Lihnrs~F~dkQvi  313 (804)
T KOG0478|consen  234 NLNPNDIDKLISISGMVIRSSEVIPEMVEAFFRCSVCGHEIAVESDRGRIKEPMLCKECGTTNSFQLLHNRSEFADKQVI  313 (804)
T ss_pred             cCChhhhhheEEeeeEEEecCCCCHHHHhHhhhhhhcCceEEEEeecCccCCCcccccccCcccceeehhhhhhccccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCC--------------------------------------------------------------------------
Q psy17703        338 RLQETP--------------------------------------------------------------------------  343 (720)
Q Consensus       338 klQE~p--------------------------------------------------------------------------  343 (720)
                      |+||.|                                                                          
T Consensus       314 klqEspd~~p~g~tPhtv~v~~~~dLVD~v~pGDrv~VTGi~ra~p~r~np~~r~vkSvyktyldvvh~rk~s~~rl~~~  393 (804)
T KOG0478|consen  314 KLQESPDDMPEGSTPHTVSVVLHNDLVDKVRPGDRVEVTGILRATPVRVNPRMRMVKSVYKTYLDVVHIRKASMKRLEGS  393 (804)
T ss_pred             eeeeccccCcCCCCCceEEEEEehhhhhccCCCCeEEEEEEEEeEEeccCcchhhHHHHHHHHhHhhhhhhhhhhhcccc
Confidence            999998                                                                          


Q ss_pred             -------------------------------------------------------------------CCccEEEEcCCCC
Q psy17703        344 -------------------------------------------------------------------AEINILLCGDPGT  356 (720)
Q Consensus       344 -------------------------------------------------------------------g~i~vLL~G~PGt  356 (720)
                                                                                         |+|||||+|||||
T Consensus       394 d~~d~~~~~~~~~~e~i~elskrpdiy~lLa~SiAPsIye~edvKkglLLqLfGGt~k~~~~~~~~R~~INILL~GDPGt  473 (804)
T KOG0478|consen  394 DERDVDEVRRIEDLEKIQELSKRPDIYELLARSIAPSIYELEDVKKGLLLQLFGGTRKEDEKSGRFRGDINILLVGDPGT  473 (804)
T ss_pred             ccccccccccHHHHHHHHHHhcCccHHHHHHHhhchhhhcccchhhhHHHHHhcCCcccccccccccccceEEEecCCCc
Confidence                                                                               6799999999999


Q ss_pred             HHHHHHHHHHhhCCCCccccCCccccccccceeecCccccceeeecceeeecCCceeeccccccCChHHHHHHHHHHHhc
Q psy17703        357 SKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQ  436 (720)
Q Consensus       357 GKS~ll~~va~~~pr~~~~~g~~ss~~glta~~~~~~~~~~~~~~~G~l~lad~gI~~IDEidkm~~~~~~~L~e~mE~~  436 (720)
                      |||||++|+++++||++|++|++++++|+|+++++|+.+++|+++.|+|+++|+|||||||||||+.+.|+.|||+||||
T Consensus       474 sKSqlLqyv~~l~pRg~yTSGkGsSavGLTayVtrd~dtkqlVLesGALVLSD~GiCCIDEFDKM~dStrSvLhEvMEQQ  553 (804)
T KOG0478|consen  474 SKSQLLQYCHRLLPRGVYTSGKGSSAVGLTAYVTKDPDTRQLVLESGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQ  553 (804)
T ss_pred             CHHHHHHHHHHhCCcceeecCCccchhcceeeEEecCccceeeeecCcEEEcCCceEEchhhhhhhHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeeeccCeEEeecCceEEEecccCCCCCCCCCcccccccCCChhhhccceeEEEecCCChHHHHHHHHhhc--------
Q psy17703        437 TLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHL--------  508 (720)
Q Consensus       437 ~vsi~k~g~~~~l~a~~~iiaaaNp~~g~~~~~~~~~~~~~l~~aLlsRFdli~~l~d~~~~~~d~~la~~i--------  508 (720)
                      +++|+|||++++||+|++|+|++||.+++||+.+++.+|++|||+|||||||+|.+.|++++..|++|+.|+        
T Consensus       554 TvSIAKAGII~sLNAR~SVLAaANP~~skynp~k~i~eNI~LpptLLSRFDLIylllD~~DE~~Dr~La~HivsLy~e~~  633 (804)
T KOG0478|consen  554 TLSIAKAGIIASLNARCSVLAAANPIRSKYNPNKSIIENINLPPTLLSRFDLIFLLLDKPDERSDRRLADHIVALYPETG  633 (804)
T ss_pred             hhhHhhcceeeeccccceeeeeeccccccCCCCCchhhccCCChhhhhhhcEEEEEecCcchhHHHHHHHHHHHhccccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998        


Q ss_pred             --------chhHHHHHHHHHHhhcCCcchHHHHHHHHHHHHHhhhcCCCCCCcccCHHHHHHHHHHHHHHHHHcCCCCCC
Q psy17703        509 --------DITVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVE  580 (720)
Q Consensus       509 --------~~~~l~~~i~~ar~~~~p~ls~ea~~~l~~~y~~lr~~~~~~~~~~~t~R~le~lirla~A~A~l~~~~~V~  580 (720)
                              +..+++.|+.||++.++|.+++|+.+.+..+|+.+|+.+...+.+..|+||+|+|+|++||||++++++.|.
T Consensus       634 ~~~~~~~~d~~~lr~yi~yArk~i~p~l~~ea~~~l~~ayvd~rk~~~~~~~itat~rQlesLiRlsEahak~r~s~~ve  713 (804)
T KOG0478|consen  634 EKQGSEAIDMNLLRDYIRYARKNIHPALSPEASQALIQAYVDMRKIGEGAGQITATPRQLESLIRLSEAHAKMRLSNRVE  713 (804)
T ss_pred             ccchhHHHhHHHHHHHHHHHhccCCccccHHHHHHHHHHhhhhhhhcccccccchhHHHHHHHHHHHHHHHHhhcccccc
Confidence                    667899999999999999999999999999999999998877788999999999999999999999999999


Q ss_pred             HHhHHHHHHHHHHHHHHhccCCCCCcceeeeeccCCCHHHHHHHHHHHHHHHHHHHH
Q psy17703        581 VQDVDEAWRLHREALKQSATDPLSGKIDVSILTTGVSSAARQRQLELTAALKKLVIL  637 (720)
Q Consensus       581 ~~Dv~~Ai~l~~~~l~~~~~d~~~g~~d~~~~~~g~~~~~~~~~~~~~~~i~~~~~~  637 (720)
                      ..|+++|++|++++++++++||.+|.+|++++++|.+...++.++.+.+++.++++.
T Consensus       714 ~~dV~eA~~l~R~aL~~~a~d~~tg~vd~~~l~tg~s~~~~~~~~~~~~ai~~~l~~  770 (804)
T KOG0478|consen  714 EIDVEEAVRLLREALKQSATDPATGKVDMDILATGNSVVSRKKVEILGGAILKMLKD  770 (804)
T ss_pred             hhhHHHHHHHHHHHhcccCCCCCCCceeehhhhhcccccchHHHHHHHHHHHHHhHH
Confidence            999999999999999999999999999999999999999999888888888887763



>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>KOG0481|consensus Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG0479|consensus Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>KOG0481|consensus Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>KOG0479|consensus Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PF14551 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1LTL_E Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13148 DUF3987: Protein of unknown function (DUF3987) Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>KOG2545|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>KOG3595|consensus Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG2383|consensus Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
3f9v_A595 Crystal Structure Of A Near Full-Length Archaeal Mc 1e-52
3f9v_A 595 Crystal Structure Of A Near Full-Length Archaeal Mc 5e-17
3f8t_A506 Crystal Structure Analysis Of A Full-Length Mcm Hom 2e-24
3f8t_A 506 Crystal Structure Analysis Of A Full-Length Mcm Hom 5e-05
1ltl_A279 The Dodecamer Structure Of Mcm From Archaeal M. The 5e-08
2vl6_A268 Structural Analysis Of The Sulfolobus Solfataricus 3e-07
>pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 Back     alignment and structure

Iteration: 1

Score = 204 bits (519), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 111/264 (42%), Positives = 159/264 (60%), Gaps = 16/264 (6%) Query: 344 AEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTG 403 +I+IL+ GDPGT+KSQ+L ++ + PR+ YT+GKGS+A GLTA + ++ T + L+ G Sbjct: 326 GDIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAG 385 Query: 404 ALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCD 463 ALVLAD G+ IDE DKM D R +HE MEQQT+SIAKAGI+ +LNAR +++AA NP Sbjct: 386 ALVLADGGIAVIDEIDKMRDEDRVAIHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKF 445 Query: 464 SQWNTSKTIIDNIRLPHTXXXXXXXXXXXXXPQSEQFDARLARH-------------LDI 510 ++ + + + DNI LP T EQ D LA + +DI Sbjct: 446 GRYISERPVSDNINLPPTILSRFDLIFILKDQPGEQ-DRELANYILDVHSGKSTKNIIDI 504 Query: 511 TVLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGAGR--GRISAYPRQLESLIRLSE 568 LR YIAYA+++++P ++ EA + +V+MRK + I PRQLE+LIR+SE Sbjct: 505 DTLRKYIAYARKYVTPKITSEAKNLITDFFVEMRKKSSETPDSPILITPRQLEALIRISE 564 Query: 569 AHAKMRYSETVEVQDVDEAWRLHR 592 A+AKM V +D + A + R Sbjct: 565 AYAKMALKAEVTREDAERAINIMR 588
>pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 Back     alignment and structure
>pdb|3F8T|A Chain A, Crystal Structure Analysis Of A Full-Length Mcm Homolog From Methanopyrus Kandleri Length = 506 Back     alignment and structure
>pdb|3F8T|A Chain A, Crystal Structure Analysis Of A Full-Length Mcm Homolog From Methanopyrus Kandleri Length = 506 Back     alignment and structure
>pdb|1LTL|A Chain A, The Dodecamer Structure Of Mcm From Archaeal M. Thermoautotrophicum Length = 279 Back     alignment and structure
>pdb|2VL6|A Chain A, Structural Analysis Of The Sulfolobus Solfataricus Mcm Protein N-Terminal Domain Length = 268 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 1e-149
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 1e-46
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 1e-41
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 2e-38
3f8t_A506 Predicted ATPase involved in replication control, 1e-130
3f8t_A 506 Predicted ATPase involved in replication control, 2e-28
3f8t_A506 Predicted ATPase involved in replication control, 1e-22
3f8t_A506 Predicted ATPase involved in replication control, 5e-05
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 4e-53
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 1e-20
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 2e-50
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 2e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 2e-11
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 4e-04
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 8e-05
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
 Score =  445 bits (1146), Expect = e-149
 Identities = 122/270 (45%), Positives = 173/270 (64%), Gaps = 16/270 (5%)

Query: 345 EINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGSSAVGLTAYITKDPETRQMVLQTGA 404
           +I+IL+ GDPGT+KSQ+L ++  + PR+ YT+GKGS+A GLTA + ++  T +  L+ GA
Sbjct: 327 DIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGA 386

Query: 405 LVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDS 464
           LVLAD G+  IDE DKM D  R  +HE MEQQT+SIAKAGI+ +LNAR +++AA NP   
Sbjct: 387 LVLADGGIAVIDEIDKMRDEDRVAIHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKFG 446

Query: 465 QWNTSKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARH-------------LDIT 511
           ++ + + + DNI LP T+LSRFDLIF+L D   EQ D  LA +             +DI 
Sbjct: 447 RYISERPVSDNINLPPTILSRFDLIFILKDQPGEQ-DRELANYILDVHSGKSTKNIIDID 505

Query: 512 VLRDYIAYAQEHLSPTLSEEASQRLIQTYVDMRKLGA--GRGRISAYPRQLESLIRLSEA 569
            LR YIAYA+++++P ++ EA   +   +V+MRK  +      I   PRQLE+LIR+SEA
Sbjct: 506 TLRKYIAYARKYVTPKITSEAKNLITDFFVEMRKKSSETPDSPILITPRQLEALIRISEA 565

Query: 570 HAKMRYSETVEVQDVDEAWRLHREALKQSA 599
           +AKM     V  +D + A  + R  L+   
Sbjct: 566 YAKMALKAEVTREDAERAINIMRLFLESVG 595


>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Length = 268 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Length = 268 Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Length = 279 Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Length = 279 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
3f8t_A506 Predicted ATPase involved in replication control, 100.0
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 100.0
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 99.96
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 99.96
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.88
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.88
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.86
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.86
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.76
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 99.69
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.58
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.57
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.57
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.55
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.53
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.48
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.46
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.43
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.41
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.4
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.4
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.38
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.37
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.36
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 99.36
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.36
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.35
3pvs_A447 Replication-associated recombination protein A; ma 99.33
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.33
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.32
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.3
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.29
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.28
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.28
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.28
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.27
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.26
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.26
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.25
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.25
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.25
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.24
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.23
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.23
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.22
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.21
3co5_A143 Putative two-component system transcriptional RES 99.18
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.16
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.14
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.12
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.12
3bos_A242 Putative DNA replication factor; P-loop containing 99.12
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.11
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.11
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.09
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.06
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.06
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.04
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.04
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.03
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.03
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.02
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.0
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 98.99
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.99
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.98
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.97
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.96
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.94
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.94
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.93
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.89
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.84
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.83
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.83
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.82
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.79
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.78
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.78
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.77
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.76
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.69
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 98.67
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.66
3f8t_A 506 Predicted ATPase involved in replication control, 98.65
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.61
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.58
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.54
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.53
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.47
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.45
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.44
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.44
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.31
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.14
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.06
1tue_A212 Replication protein E1; helicase, replication, E1E 97.96
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.72
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.57
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.55
2qgz_A308 Helicase loader, putative primosome component; str 97.18
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.09
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.84
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.6
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.56
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.41
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.85
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.67
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 94.59
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.26
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.11
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.57
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.52
1via_A175 Shikimate kinase; structural genomics, transferase 93.47
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.39
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.35
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.15
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.13
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.92
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 92.88
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 92.84
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.83
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.71
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.45
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.43
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.34
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 92.32
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.3
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.3
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.27
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.2
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.2
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.09
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 92.06
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.03
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.03
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.0
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.0
2r44_A 331 Uncharacterized protein; putative ATPase, structur 91.98
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 91.94
2vli_A183 Antibiotic resistance protein; transferase, tunica 91.92
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 91.9
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 91.86
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 91.85
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 91.72
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.71
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.7
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 91.68
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 91.68
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.53
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.47
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 91.47
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.46
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 91.36
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.36
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.32
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.31
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.3
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.29
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 91.29
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.94
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 90.92
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 90.86
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.86
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 90.65
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.61
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.5
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.44
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.43
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.39
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 90.35
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 90.34
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.23
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 90.21
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 90.19
3tlx_A243 Adenylate kinase 2; structural genomics, structura 90.12
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 90.1
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 90.06
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 90.05
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 90.02
3t1o_A198 Gliding protein MGLA; G domain containing protein, 90.01
3lxx_A239 GTPase IMAP family member 4; structural genomics c 89.99
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 89.98
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 89.97
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 89.95
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 89.8
4a74_A231 DNA repair and recombination protein RADA; hydrola 89.77
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 89.76
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 89.67
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 89.66
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 89.65
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 89.64
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 89.63
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.63
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 89.59
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 89.58
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 89.58
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 89.57
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 89.49
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 89.49
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 89.42
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 89.38
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 89.33
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 89.33
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 89.33
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.32
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 89.27
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 89.24
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 89.18
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 89.1
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 89.09
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 89.06
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 89.05
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 89.03
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.01
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.99
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 88.98
1nrj_B218 SR-beta, signal recognition particle receptor beta 88.95
3o47_A329 ADP-ribosylation factor GTPase-activating protein 88.93
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 88.88
3lxw_A247 GTPase IMAP family member 1; immunity, structural 88.84
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.83
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 88.8
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 88.78
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.71
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 88.69
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 88.54
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 88.51
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 88.46
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 88.43
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 88.43
2wji_A165 Ferrous iron transport protein B homolog; membrane 88.4
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 88.39
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 88.35
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 88.33
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 88.31
2ged_A193 SR-beta, signal recognition particle receptor beta 88.27
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 88.26
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 88.26
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 88.19
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 88.18
3r20_A233 Cytidylate kinase; structural genomics, seattle st 88.17
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 88.16
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 88.1
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 88.09
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.08
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 88.05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 88.03
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 88.01
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 88.0
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 87.96
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 87.92
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 87.92
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 87.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 87.88
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 87.86
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 87.85
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 87.83
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 87.75
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 87.71
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 87.69
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 87.69
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 87.65
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.64
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 87.64
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 87.61
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 87.57
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 87.56
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 87.5
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 87.45
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 87.45
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 87.44
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 87.42
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 87.38
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 87.38
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 87.33
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 87.29
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 87.27
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 87.24
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 87.2
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 87.15
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 87.12
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 87.11
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 87.1
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.08
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.08
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 87.06
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 87.03
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 87.0
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 86.97
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 86.95
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 86.89
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 86.87
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 86.82
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 86.77
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 86.69
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 86.63
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 86.61
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 86.57
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 86.56
3llu_A196 RAS-related GTP-binding protein C; structural geno 86.52
1sgw_A214 Putative ABC transporter; structural genomics, P p 86.49
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.45
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 86.37
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 86.35
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 86.35
2eyu_A261 Twitching motility protein PILT; pilus retraction 86.34
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 86.28
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 86.24
1g6h_A257 High-affinity branched-chain amino acid transport 86.2
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 86.19
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 86.19
1b0u_A262 Histidine permease; ABC transporter, transport pro 86.11
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 86.11
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 86.04
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 86.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 85.99
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 85.98
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 85.96
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 85.95
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 85.94
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 85.92
2fna_A357 Conserved hypothetical protein; structural genomic 85.87
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 85.84
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 85.8
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 85.79
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 85.77
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 85.76
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 85.72
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 85.71
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 85.7
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 85.7
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.66
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 85.62
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 85.57
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.56
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 85.53
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 85.52
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 85.52
3kta_A182 Chromosome segregation protein SMC; structural mai 85.48
2fh5_B214 SR-beta, signal recognition particle receptor beta 85.4
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 85.37
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 85.28
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 85.24
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 85.2
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 85.2
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 85.15
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 85.13
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 85.12
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 85.11
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 85.1
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 85.07
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 85.07
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 84.98
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 84.95
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 84.93
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 84.92
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 84.81
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 84.72
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 84.7
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 84.68
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 84.61
1p9r_A418 General secretion pathway protein E; bacterial typ 84.54
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 84.53
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 84.25
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 84.24
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 84.2
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 84.19
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 84.15
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 84.08
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 84.07
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 84.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 83.92
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 83.91
2ghi_A260 Transport protein; multidrug resistance protein, M 83.9
2ewv_A372 Twitching motility protein PILT; pilus retraction 83.89
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 83.86
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 83.85
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 83.79
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 83.61
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 83.46
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 83.42
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 83.39
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 83.31
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 83.24
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 83.15
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 83.11
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 83.09
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 83.07
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 83.02
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 82.88
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 82.86
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 82.84
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 82.81
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 82.74
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 82.68
2z43_A324 DNA repair and recombination protein RADA; archaea 82.57
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 82.54
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 82.51
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 82.31
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 82.31
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 82.31
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 82.21
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 82.19
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 82.18
2hf9_A226 Probable hydrogenase nickel incorporation protein 82.15
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 82.0
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 81.97
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 81.91
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 81.82
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 81.73
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 81.47
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 81.44
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 81.41
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 81.36
3iby_A256 Ferrous iron transport protein B; G protein, G dom 81.34
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 81.3
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 81.27
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 81.25
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 81.17
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 81.16
3io5_A333 Recombination and repair protein; storage dimer, i 81.09
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 81.06
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 81.06
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 81.03
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 80.98
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 80.97
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 80.94
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 80.85
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 80.74
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 80.71
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 80.69
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 80.61
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 80.56
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 80.53
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 80.42
1xjc_A169 MOBB protein homolog; structural genomics, midwest 80.41
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 80.39
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 80.22
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 80.18
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 80.82
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
Probab=100.00  E-value=5.2e-70  Score=595.59  Aligned_cols=363  Identities=34%  Similarity=0.470  Sum_probs=311.4

Q ss_pred             CCCCCCceEEEEEEcccccc------cccCCCeEEEEEEEEeccCCCCccccccccceeEEEEEEEEEEecccccccccc
Q psy17703          1 MPAGQTPHSVVLFTYNDLVD------SIQPGDRVTVTGIYRAVPLQVNPRMRSVKSVYKTHIDVVHFRKIDATRLYKQDE   74 (720)
Q Consensus         1 VP~G~~Prsi~v~~~~dLvd------~~~PGD~V~vtGi~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~   74 (720)
                      ||.|++||+++|++++||||      +|+|||+|+|+|||++.                 |++++|+++.       +..
T Consensus       128 ~~~G~~Prsi~v~l~~dLvd~~~~~~~~~pGd~V~v~GI~~~~-----------------~l~a~~i~~~-------~~~  183 (506)
T 3f8t_A          128 VRGAERLEHAIVDTGSELVAVRLHGHRLGPGLRVEILGIVRSA-----------------TLDALEVHKK-------DPI  183 (506)
T ss_dssp             EEESSSEEEEEEECSSSEEEEECTTCCCCTTCEEEEEEEEETT-----------------EEEEEEEEEE-------CSS
T ss_pred             CCCCCCCceEEEEecccccCcccccccccCCCEEEEEEEEEEe-----------------EEEEEEEEEc-------Ccc
Confidence            68999999999999999999      99999999999999853                 8999999872       123


Q ss_pred             cCCCCChHHHHHHHhhhcCCcHHHHHHHhhchhccCchhhHHHHHHHhhCCcccccccccccCCcccccCCCcccCCCCC
Q psy17703         75 KEHKFPPERVELLKSLSRKPDIYERLTSAICPSIYGYEDVKKGIMLQMFGGTKKTFDETISDRMSEIDLASPLNYGTPSS  154 (720)
Q Consensus        75 ~~~~~~~~~~~~i~~l~~~~~iy~~l~~SiaPsI~G~~~VKk~lll~L~GG~~k~~~~~~~~~~~~~~~~~~l~~g~~~~  154 (720)
                      ....||+++++.|++++++ ++|++|++|||| ||||++||+||+|+|+||.+|.                         
T Consensus       184 ~~~~~t~ed~~~i~~l~~~-~~~~~l~~sIap-I~G~e~vK~aLll~L~GG~~k~-------------------------  236 (506)
T 3f8t_A          184 PEVHPDPAELEEFRELADK-DPLTTFARAIAP-LPGAEEVGKMLALQLFSCVGKN-------------------------  236 (506)
T ss_dssp             CCCCCCHHHHHHHHHHHHS-CHHHHHHHHHCC-STTCHHHHHHHHHHHTTCCSSG-------------------------
T ss_pred             ccCCCCHHHHHHHHHHHHH-HHHHHHHHHhcc-cCCCHHHHHHHHHHHcCCcccc-------------------------
Confidence            4567999999999999999 999999999999 9999999999999999999651                         


Q ss_pred             ccccccCCCCCcCCccccCCCchhhHHHHHHHhcCCcEEEEechhHhhhcHHHHHHHHhChhhHHHHHHHHHHHHHHhhC
Q psy17703        155 IGSLRTPRSGIQGTPIRLRPDIRTDRRIRQIFSLEDPVLNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERH  234 (720)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~l~id~~~l~~~d~~L~~~l~~~P~~~i~~~~~~i~~~~~~~~  234 (720)
                                                                                                      
T Consensus       237 --------------------------------------------------------------------------------  236 (506)
T 3f8t_A          237 --------------------------------------------------------------------------------  236 (506)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccccccceEEEecCCccccccccCCCcCCCceEEEeeEEEEecccchhhhhheeecccCCceeeeeeccCcccCCccCC
Q psy17703        235 PAAVLEHQIQVRPFNAKKTRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTLCT  314 (720)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~r~l~~~~i~~lv~v~Giv~r~s~v~p~~~~~~f~C~~Cg~~~~~~~~~~~~~~p~~C~  314 (720)
                                                                                           +          
T Consensus       237 ---------------------------------------------------------------------r----------  237 (506)
T 3f8t_A          237 ---------------------------------------------------------------------S----------  237 (506)
T ss_dssp             ---------------------------------------------------------------------G----------
T ss_pred             ---------------------------------------------------------------------C----------
Confidence                                                                                 0          


Q ss_pred             CCCCCCcceeeccCCccchhhhhhhhcCCCCccEEEEcCCCCHHHHHHHHH-HhhCCCCccccCCccccccccceeecCc
Q psy17703        315 NCSTNHCFSLVHNRSHFTDKQLVRLQETPAEINILLCGDPGTSKSQLLSYV-YDLVPRSQYTSGKGSSAVGLTAYITKDP  393 (720)
Q Consensus       315 ~C~~~~~~~~~~~~s~~~d~Q~iklQE~pg~i~vLL~G~PGtGKS~ll~~v-a~~~pr~~~~~g~~ss~~glta~~~~~~  393 (720)
                                                   +++||||+|+||| ||+||+++ ++++||.+|++|..++..++++. .+++
T Consensus       238 -----------------------------gdihVLL~G~PGt-KS~Lar~i~~~i~pR~~ft~g~~ss~~gLt~s-~r~~  286 (506)
T 3f8t_A          238 -----------------------------ERLHVLLAGYPVV-CSEILHHVLDHLAPRGVYVDLRRTELTDLTAV-LKED  286 (506)
T ss_dssp             -----------------------------GCCCEEEESCHHH-HHHHHHHHHHHTCSSEEEEEGGGCCHHHHSEE-EEES
T ss_pred             -----------------------------CceeEEEECCCCh-HHHHHHHHHHHhCCCeEEecCCCCCccCceEE-EEcC
Confidence                                         5899999999999 99999999 99999999999998888899988 6666


Q ss_pred             cccceeeecceeeecCCceeeccccccCChHHHHHHHHHHHhceEeeeccCeEEeecCceEEEecccCCCCCCCCCcccc
Q psy17703        394 ETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNTSKTII  473 (720)
Q Consensus       394 ~~~~~~~~~G~l~lad~gI~~IDEidkm~~~~~~~L~e~mE~~~vsi~k~g~~~~l~a~~~iiaaaNp~~g~~~~~~~~~  473 (720)
                       +| |.+++|++++||+|+||+|||++|+++.|++||++||++++++.  |.  ++|++|+||||+||++ +|+..+++ 
T Consensus       287 -tG-~~~~~G~l~LAdgGvl~lDEIn~~~~~~qsaLlEaMEe~~VtI~--G~--~lparf~VIAA~NP~~-~yd~~~s~-  358 (506)
T 3f8t_A          287 -RG-WALRAGAAVLADGGILAVDHLEGAPEPHRWALMEAMDKGTVTVD--GI--ALNARCAVLAAINPGE-QWPSDPPI-  358 (506)
T ss_dssp             -SS-EEEEECHHHHTTTSEEEEECCTTCCHHHHHHHHHHHHHSEEEET--TE--EEECCCEEEEEECCCC---CCSCGG-
T ss_pred             -CC-cccCCCeeEEcCCCeeehHhhhhCCHHHHHHHHHHHhCCcEEEC--CE--EcCCCeEEEEEeCccc-ccCCCCCc-
Confidence             78 99999999999999999999999999999999999999999996  76  9999999999999999 89888888 


Q ss_pred             cccCCChhhhccceeEEEecCCChHHHHHH-HHhhcchhHHHHHHHHHH-hhcCCcchHHHHHHHHHHHHHhhhcCC---
Q psy17703        474 DNIRLPHTLLSRFDLIFLLLDPQSEQFDAR-LARHLDITVLRDYIAYAQ-EHLSPTLSEEASQRLIQTYVDMRKLGA---  548 (720)
Q Consensus       474 ~~~~l~~aLlsRFdli~~l~d~~~~~~d~~-la~~i~~~~l~~~i~~ar-~~~~p~ls~ea~~~l~~~y~~lr~~~~---  548 (720)
                      +|+.||++++||||+++.+.|.++++.|.. ....++.+.+++|+.||| ++++|.+++++.+.|.++|..+|....   
T Consensus       359 ~~~~Lp~alLDRFDLi~i~~d~pd~e~d~e~~~~~ls~e~L~~yi~~ar~~~~~p~ls~ea~~yI~~~y~~tR~~~~~~~  438 (506)
T 3f8t_A          359 ARIDLDQDFLSHFDLIAFLGVDPRPGEPEEQDTEVPSYTLLRRYLLYAIREHPAPELTEEARKRLEHWYETRREEVEERL  438 (506)
T ss_dssp             GGCCSCHHHHTTCSEEEETTC--------------CCHHHHHHHHHHHHHHCSCCEECHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccCCChHHhhheeeEEEecCCCChhHhhcccCCCCCHHHHHHHHHHHHhcCCCceeCHHHHHHHHHHHHHHhcCccccc
Confidence            999999999999999999998887766542 223458899999999999 788999999999999999999997311   


Q ss_pred             --CCCCcccCHHHHHHHHHHHHHHHHHcCCCCCCHHhHHHHHHHHHHHHHHhccCCCCCcceeeee
Q psy17703        549 --GRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLHREALKQSATDPLSGKIDVSIL  612 (720)
Q Consensus       549 --~~~~~~~t~R~le~lirla~A~A~l~~~~~V~~~Dv~~Ai~l~~~~l~~~~~d~~~g~~d~~~~  612 (720)
                        ....+++|+|++++|+|+|+|+|+|++|+.|+++|+.+|++|++.|++++++||++|.+|++++
T Consensus       439 ~~~~~~~giSpR~leaLiRlA~A~A~L~gR~~V~~eDV~~Ai~L~~~Sl~~~a~dp~tg~id~~~~  504 (506)
T 3f8t_A          439 GMGLPTLPVTRRQLESVERLAKAHARMRLSDDVEPEDVDIAAELVDWYLETAMQIPGGDEIRISSL  504 (506)
T ss_dssp             HTTCCCCCCCHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHHHHHHHTTC------------
T ss_pred             ccccccccccHHHHHHHHHHHHHHHHHcCcCCCCHHHHHHHHHHHHHHHHHhcCCCCCCeEeEEec
Confidence              1246789999999999999999999999999999999999999999999999999999999876



>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 720
d1ltla_239 b.40.4.11 (A:) DNA replication initiator (cdc21/cd 4e-32
d1ltla_239 b.40.4.11 (A:) DNA replication initiator (cdc21/cd 9e-14
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 1e-14
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 0.002
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
 Score =  122 bits (307), Expect = 4e-32
 Identities = 44/170 (25%), Positives = 69/170 (40%), Gaps = 15/170 (8%)

Query: 193 LNVNLAHLAKFDSQLCQQLVCYPQEVIPILDMGVNEYFFERHPAAVLEHQIQVRPFNAKK 252
           + V+   L  FD  L   L+  P +VI      +      R         + +R      
Sbjct: 36  IEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRNIDRLRK-----NVDLNIRFSGISN 90

Query: 253 TRNLRHLNPEDIDQLITINGMVIRTSNIIPEMREAFFRCIVCNYSTTVEIDRGRIHEPTL 312
              LR L  + I + + ++G+V +T  I P + +A F C  C     V      I EP+L
Sbjct: 91  VIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVTQSTNMITEPSL 150

Query: 313 CTNCSTNHCFSLVHNRSHFTDKQLVRLQE---------TPAEINILLCGD 353
           C+ C     F L+ + S F D Q ++LQE          P +I ++L  D
Sbjct: 151 CSECG-GRSFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDD 199


>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.96
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 99.93
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.51
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.5
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.4
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.29
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.28
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.27
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.26
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.25
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.22
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.21
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.2
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.13
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.13
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.09
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.07
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.93
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.92
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.82
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.71
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.69
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.65
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.59
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.49
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.38
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.26
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.24
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.24
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.16
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.97
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.86
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.69
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.59
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.59
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.59
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.56
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.32
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.28
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.27
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.26
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.04
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.53
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.49
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.33
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.32
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.27
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.19
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.13
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.1
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.08
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.97
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.94
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.88
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.73
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.55
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.36
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.35
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.2
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.12
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.1
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.04
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.78
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.7
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.66
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.6
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.56
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.54
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.33
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.95
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.62
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.52
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.41
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.2
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.06
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.92
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.9
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 91.75
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.48
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.47
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.36
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.29
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.79
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.75
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.61
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 90.61
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 90.51
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.47
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.43
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.39
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.36
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.29
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.25
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.2
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.18
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.18
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.07
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.04
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.04
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.0
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.99
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.91
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.88
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.78
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.73
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.63
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.62
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.61
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 89.53
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 89.44
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.42
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.38
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.34
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.21
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.19
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.15
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.1
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.09
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 89.09
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.05
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.0
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.99
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.97
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.91
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.9
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.79
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.68
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 88.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.55
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 88.46
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.46
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.42
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.39
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.22
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 88.22
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.0
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.95
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.83
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.71
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.61
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 87.59
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.5
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.23
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.08
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.02
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.91
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 86.82
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 86.66
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.57
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.38
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.31
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 86.11
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.02
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 85.98
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.8
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.73
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.69
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.59
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.39
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 85.35
d2awna2232 Maltose transport protein MalK, N-terminal domain 85.33
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 85.26
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 85.17
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.15
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 84.98
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 84.93
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 84.61
d1okkd2207 GTPase domain of the signal recognition particle r 84.3
d1g2912240 Maltose transport protein MalK, N-terminal domain 84.1
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 84.07
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 83.98
d1j8yf2211 GTPase domain of the signal sequence recognition p 83.95
d1ls1a2207 GTPase domain of the signal sequence recognition p 83.85
d1vmaa2213 GTPase domain of the signal recognition particle r 83.71
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 83.48
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.29
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 83.29
d2qy9a2211 GTPase domain of the signal recognition particle r 83.06
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 83.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 82.9
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 82.84
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 82.75
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 82.71
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 82.64
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.57
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 82.17
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.04
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 82.0
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 81.64
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 81.01
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 80.94
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 80.02
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]
Probab=99.96  E-value=6e-29  Score=265.38  Aligned_cols=227  Identities=20%  Similarity=0.249  Sum_probs=172.4

Q ss_pred             CCccEEEEcCCCCHHHHHHHHHHhhCCCCccccCCcc---------------------------------ccccccceee
Q psy17703        344 AEINILLCGDPGTSKSQLLSYVYDLVPRSQYTSGKGS---------------------------------SAVGLTAYIT  390 (720)
Q Consensus       344 g~i~vLL~G~PGtGKS~ll~~va~~~pr~~~~~g~~s---------------------------------s~~glta~~~  390 (720)
                      +..|+||+||||||||+|++.++.++|......+...                                 +..++.+...
T Consensus        27 ~~h~vLl~G~pG~GKT~lar~~~~iLp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~~d  106 (333)
T d1g8pa_          27 GIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALD  106 (333)
T ss_dssp             GGCCEEEECCGGGCTTHHHHHHHHHSCCEEEETTCTTCCSSGGGSCTTCCCSCCCEEEECCCEEEECTTCCHHHHHCEEC
T ss_pred             CCCeEEEECCCCccHHHHHHHHHHhCCCchhhccCccccCccccccchhhccccCcccccCceeeccCCCCcccccCcch
Confidence            5579999999999999999999999986543322111                                 1111111110


Q ss_pred             --cCccccceeeecceeeecCCceeeccccccCChHHHHHHHHHHHhceEeeeccCeEEeecCceEEEecccCCCCCCCC
Q psy17703        391 --KDPETRQMVLQTGALVLADSGVCCIDEFDKMSDTTRSILHEVMEQQTLSIAKAGIICQLNARTSILAAANPCDSQWNT  468 (720)
Q Consensus       391 --~~~~~~~~~~~~G~l~lad~gI~~IDEidkm~~~~~~~L~e~mE~~~vsi~k~g~~~~l~a~~~iiaaaNp~~g~~~~  468 (720)
                        .....|.+..++|.+.+||+||+|+||+++++++.+++|+++||+++++++++|....+|++|.++||+||++++   
T Consensus       107 ~~~~~~~g~~~~~~G~l~~A~~gvl~iDEi~~~~~~~~~aLl~~me~~~v~i~r~g~~~~~p~~f~liaa~Np~~~~---  183 (333)
T d1g8pa_         107 IERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGLSIRHPARFVLVGSGNPEEGD---  183 (333)
T ss_dssp             HHHHHHHCGGGEECCHHHHHTTEEEEETTGGGSCHHHHHHHHHHHHHSEEEECCTTCCEEEECCEEEEEEECSCSCC---
T ss_pred             hhhccccCcceeeccccccccccEeecccHHHHHHHHHHHHhhhhcCCeEEecccCceecCCCCEEEEEecCccccc---
Confidence              011236788999999999999999999999999999999999999999999999999999999999999999864   


Q ss_pred             CcccccccCCChhhhccceeEEEecCCChHHHHHHHHhhc----------------chhHHHHHHHHHHhh-cCCcchHH
Q psy17703        469 SKTIIDNIRLPHTLLSRFDLIFLLLDPQSEQFDARLARHL----------------DITVLRDYIAYAQEH-LSPTLSEE  531 (720)
Q Consensus       469 ~~~~~~~~~l~~aLlsRFdli~~l~d~~~~~~d~~la~~i----------------~~~~l~~~i~~ar~~-~~p~ls~e  531 (720)
                               +++++++|||+.+.+.++.+......+..+.                ....+++.+..+... ....++++
T Consensus       184 ---------l~~~llDRf~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~v~~~~~  254 (333)
T d1g8pa_         184 ---------LRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWRPKDMDIRNQILEARERLPKVEAPNT  254 (333)
T ss_dssp             ---------CCHHHHTTCSEEEECCCCCSHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHGGGCBCCHH
T ss_pred             ---------cccchhhhhcceeeccCcchhhHHHHHHHhhhhcccChHHHHHHHHHHHHHHHHHHHHHhhcccceecCHH
Confidence                     8999999999999999887655443333221                111223333333332 24456777


Q ss_pred             HHHHHHHHHHHhhhcCCCCCCcccCHHHHHHHHHHHHHHHHHcCCCCCCHHhHHHHHHHH
Q psy17703        532 ASQRLIQTYVDMRKLGAGRGRISAYPRQLESLIRLSEAHAKMRYSETVEVQDVDEAWRLH  591 (720)
Q Consensus       532 a~~~l~~~y~~lr~~~~~~~~~~~t~R~le~lirla~A~A~l~~~~~V~~~Dv~~Ai~l~  591 (720)
                      ....+...+.++..         .++|....++|+|+++|+|++++.|+.+|+.+|+.+.
T Consensus       255 ~~~~~~~~~~~~~~---------~S~R~~~~llrvArtiA~L~gr~~V~~~di~~a~~lv  305 (333)
T d1g8pa_         255 ALYDCAALCIALGS---------DGLRGELTLLRSARALAALEGATAVGRDHLKRVATMA  305 (333)
T ss_dssp             HHHHHHHHHHHSSS---------CSHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCC---------CChHHHHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHH
Confidence            77777766665543         2579999999999999999999999999999998863



>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure