Diaphorina citri psyllid: psy17710


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MTVHAVHIKTKLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQVTIPPTPGESFVSISRDLLKFIW
cccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHc
***HAVHIKTKLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQVTIPPTPGESFVSISRDLLKFIW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVHAVHIKTKLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQVTIPPTPGESFVSISRDLLKFIW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurofibromin Stimulates the GTPase activity of Ras. NF1 shows greater affinity for Ras GAP, but lower specific activity. May be a regulator of Ras activity.confidentQ04690
Neurofibromin Stimulates the GTPase activity of Ras. NF1 shows greater affinity for Ras GAP, but lower specific activity. May be a regulator of Ras activity.confidentP21359
Neurofibromin Stimulates the GTPase activity of Ras. NF1 shows greater affinity for Ras GAP, but lower specific activity. May be a regulator of Ras activity.confidentP97526

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046578 [BP]regulation of Ras protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0050890 [BP]cognitionprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005099 [MF]Ras GTPase activator activityprobableGO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0043535 [BP]regulation of blood vessel endothelial cell migrationprobableGO:0030334, GO:0010594, GO:0010632, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:0051239, GO:0065007, GO:0032879, GO:0050794, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045765 [BP]regulation of angiogenesisprobableGO:0022603, GO:0050793, GO:0008150, GO:1901342, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0042063 [BP]gliogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:1900542 [BP]regulation of purine nucleotide metabolic processprobableGO:0019220, GO:0080090, GO:0019222, GO:0008150, GO:0019219, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0051171, GO:0006140, GO:0050789
GO:0001936 [BP]regulation of endothelial cell proliferationprobableGO:0042127, GO:0050678, GO:0050794, GO:0065007, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted