Diaphorina citri psyllid: psy17720


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MRYCSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQVAVGKR
ccccccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEECcccccccccccccccccEEEccc
*****RTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGD********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYCSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQVAVGKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative methyltransferase BUD23 Putative methyltransferase involved in positioning the proximal bud pole signal.confidentP25627
Uncharacterized methyltransferase WBSCR22 Methyltransferase that may act on DNA.confidentQ58DP0
Probable methyltransferase WBSCR22 homolog Probable DNA methyltransferase.confidentQ55DA6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0008168 [MF]methyltransferase activityprobableGO:0003824, GO:0016740, GO:0016741, GO:0003674
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XDZ, chain A
Confidence level:probable
Coverage over the Query: 2-56
View the alignment between query and template
View the model in PyMOL