Diaphorina citri psyllid: psy17721

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQSPWDKPREMYGSAAIQDFSFEKPPKYSFFSGL
ccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccc
************QFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDL*****************************************F*GL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQSPWDKPREMYGSAAIQDFSFEKPPKYSFFSGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized methyltransferase WBSCR22 Methyltransferase that may act on DNA.confidentO43709
Uncharacterized methyltransferase WBSCR22 Methyltransferase that may act on DNA.confidentQ58DP0
Probable methyltransferase WBSCR22 homolog Probable DNA methyltransferase.confidentQ55DA6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E23, chain A
Confidence level:probable
Coverage over the Query: 18-81
View the alignment between query and template
View the model in PyMOL