Psyllid ID: psy17721


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQSPWDKPREMYGSAAIQDFSFEKPPKYSFFSGL
ccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEEccccccccccccccccccccccccccccccHHccccccccccccccccc
ccccccccccHcccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEcccccccccccccccccccHHHHHHHHccccccccccccccccccccccc
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFqfypensaQIELVTSQAMRAGFYGGlvvdyphstkaKKFFLVLMtggdlplppalgegegsqspwdkpremygsaaiqdfsfekppkysffsgl
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQSPWDKPREMYGSAAiqdfsfekppkysffsgl
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQSPWDKPREMYGSAAIQDFSFEKPPKYSFFSGL
************QFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDL*********************************************
***************LKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGG*******************************************F*GL
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALG*********DKPREMYGSAAIQDFSFEKPPKYSFFSGL
***********AQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLP********************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNLDLRSISKAQFSLKQISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGGDLPLPPALGEGEGSQSPWDKPREMYGSAAIQDFSFEKPPKYSFFSGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q55DA6287 Probable methyltransferas yes N/A 0.530 0.240 0.579 4e-19
Q58DP0281 Uncharacterized methyltra yes N/A 0.592 0.274 0.558 2e-18
Q9CY21281 Uncharacterized methyltra yes N/A 0.553 0.256 0.583 3e-18
O43709281 Uncharacterized methyltra yes N/A 0.592 0.274 0.545 7e-18
Q10162268 Putative methyltransferas yes N/A 0.492 0.238 0.437 7e-11
P25627275 Putative methyltransferas yes N/A 0.453 0.214 0.474 4e-09
>sp|Q55DA6|WBS22_DICDI Probable methyltransferase WBSCR22 homolog OS=Dictyostelium discoideum GN=DDB_G0269722 PE=3 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 55/69 (79%)

Query: 24  LFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGG 83
           LF  L+R  +A+ QFYPENSAQIE++T+ A+R GF GGL++D+P+S+KAKK+FLVL TG 
Sbjct: 146 LFNVLTRGGKAILQFYPENSAQIEMITASALRCGFSGGLLIDFPNSSKAKKYFLVLFTGN 205

Query: 84  DLPLPPALG 92
           +  +P A G
Sbjct: 206 NNIMPSAKG 214




Probable DNA methyltransferase.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q58DP0|WBS22_BOVIN Uncharacterized methyltransferase WBSCR22 OS=Bos taurus GN=WBSCR22 PE=2 SV=1 Back     alignment and function description
>sp|Q9CY21|WBS22_MOUSE Uncharacterized methyltransferase WBSCR22 OS=Mus musculus GN=Wbscr22 PE=2 SV=1 Back     alignment and function description
>sp|O43709|WBS22_HUMAN Uncharacterized methyltransferase WBSCR22 OS=Homo sapiens GN=WBSCR22 PE=1 SV=2 Back     alignment and function description
>sp|Q10162|YAU6_SCHPO Putative methyltransferase C26A3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26A3.06 PE=4 SV=1 Back     alignment and function description
>sp|P25627|BUD23_YEAST Putative methyltransferase BUD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD23 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
157127847 275 hypothetical protein AaeL_AAEL010949 [Ae 0.676 0.32 0.696 3e-27
170030833 275 williams Beuren syndrome chromosome regi 0.676 0.32 0.674 8e-27
312378003 279 hypothetical protein AND_10530 [Anophele 0.684 0.318 0.681 3e-26
289740771 275 putative protein carboxyl methylase [Glo 0.676 0.32 0.662 3e-26
189238660 274 PREDICTED: similar to CG10903 CG10903-PA 0.576 0.273 0.76 4e-26
195344378 276 GM10995 [Drosophila sechellia] gi|195569 0.676 0.318 0.655 4e-25
194899416 276 GG14363 [Drosophila erecta] gi|190650959 0.676 0.318 0.655 7e-25
195498585 276 GE24963 [Drosophila yakuba] gi|194182687 0.707 0.333 0.607 8e-25
21355093 276 CG10903, isoform A [Drosophila melanogas 0.676 0.318 0.655 8e-25
242024724 277 conserved hypothetical protein [Pediculu 0.653 0.306 0.635 9e-25
>gi|157127847|ref|XP_001661209.1| hypothetical protein AaeL_AAEL010949 [Aedes aegypti] gi|108872791|gb|EAT37016.1| AAEL010949-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 75/89 (84%), Gaps = 1/89 (1%)

Query: 24  LFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGG 83
           LF+ L+R ARAVFQFYPENS QIELVT+QAM+AGFYGGLVVDYP+S+KAKK+FLVLMTGG
Sbjct: 146 LFSSLTRNARAVFQFYPENSDQIELVTTQAMKAGFYGGLVVDYPNSSKAKKYFLVLMTGG 205

Query: 84  DLPLPPALG-EGEGSQSPWDKPREMYGSA 111
            + LP ALG E + SQ P+ + RE+  +A
Sbjct: 206 MVKLPAALGTEEDSSQIPYSRKRELARNA 234




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170030833|ref|XP_001843292.1| williams Beuren syndrome chromosome region 22 [Culex quinquefasciatus] gi|167868411|gb|EDS31794.1| williams Beuren syndrome chromosome region 22 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312378003|gb|EFR24691.1| hypothetical protein AND_10530 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|289740771|gb|ADD19133.1| putative protein carboxyl methylase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|189238660|ref|XP_972432.2| PREDICTED: similar to CG10903 CG10903-PA [Tribolium castaneum] gi|270008360|gb|EFA04808.1| hypothetical protein TcasGA2_TC014857 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195344378|ref|XP_002038765.1| GM10995 [Drosophila sechellia] gi|195569115|ref|XP_002102557.1| GD19965 [Drosophila simulans] gi|194133786|gb|EDW55302.1| GM10995 [Drosophila sechellia] gi|194198484|gb|EDX12060.1| GD19965 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194899416|ref|XP_001979256.1| GG14363 [Drosophila erecta] gi|190650959|gb|EDV48214.1| GG14363 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195498585|ref|XP_002096586.1| GE24963 [Drosophila yakuba] gi|194182687|gb|EDW96298.1| GE24963 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|21355093|ref|NP_649762.1| CG10903, isoform A [Drosophila melanogaster] gi|442617958|ref|NP_001262365.1| CG10903, isoform B [Drosophila melanogaster] gi|7298980|gb|AAF54183.1| CG10903, isoform A [Drosophila melanogaster] gi|17945482|gb|AAL48794.1| RE22146p [Drosophila melanogaster] gi|220948154|gb|ACL86620.1| CG10903-PA [synthetic construct] gi|220957392|gb|ACL91239.1| CG10903-PA [synthetic construct] gi|440217189|gb|AGB95747.1| CG10903, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|242024724|ref|XP_002432776.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518285|gb|EEB20038.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0037543276 CG10903 [Drosophila melanogast 0.553 0.260 0.777 4.6e-25
UNIPROTKB|Q5ZI10282 WBSCR22 "Uncharacterized prote 0.530 0.244 0.637 4e-19
DICTYBASE|DDB_G0269722287 DDB_G0269722 "methyltransferas 0.553 0.250 0.589 1.1e-18
ZFIN|ZDB-GENE-070410-68282 wbscr22 "Williams Beuren syndr 0.523 0.241 0.647 1.7e-18
UNIPROTKB|Q58DP0281 WBSCR22 "Uncharacterized methy 0.592 0.274 0.558 9.5e-18
WB|WBGene00016166283 C27F2.4 [Caenorhabditis elegan 0.607 0.279 0.575 9.5e-18
UNIPROTKB|C9K060298 WBSCR22 "Uncharacterized methy 0.592 0.258 0.545 1.6e-17
UNIPROTKB|O43709281 WBSCR22 "Uncharacterized methy 0.592 0.274 0.545 1.6e-17
UNIPROTKB|F1RJN0281 WBSCR22 "Uncharacterized prote 0.592 0.274 0.558 1.6e-17
MGI|MGI:1913388281 Wbscr22 "Williams Beuren syndr 0.553 0.256 0.583 2e-17
FB|FBgn0037543 CG10903 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 4.6e-25, P = 4.6e-25
 Identities = 56/72 (77%), Positives = 63/72 (87%)

Query:    24 LFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKAKKFFLVLMTGG 83
             LF+ L+RTARAVFQFYPENS QIE+VTSQAM+AGFYGGLVVDYP+S KAKK++LVLMTGG
Sbjct:   147 LFSCLTRTARAVFQFYPENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKAKKYYLVLMTGG 206

Query:    84 DLPLPPALGEGE 95
                LP ALG  E
Sbjct:   207 SAELPQALGSPE 218




GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZI10 WBSCR22 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269722 DDB_G0269722 "methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-68 wbscr22 "Williams Beuren syndrome chromosome region 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DP0 WBSCR22 "Uncharacterized methyltransferase WBSCR22" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00016166 C27F2.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|C9K060 WBSCR22 "Uncharacterized methyltransferase WBSCR22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O43709 WBSCR22 "Uncharacterized methyltransferase WBSCR22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJN0 WBSCR22 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913388 Wbscr22 "Williams Beuren syndrome chromosome region 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q55DA6WBS22_DICDI2, ., 1, ., 1, ., -0.57970.53070.2404yesN/A
Q58DP0WBS22_BOVIN2, ., 1, ., 1, ., -0.55840.59230.2740yesN/A
O43709WBS22_HUMAN2, ., 1, ., 1, ., -0.54540.59230.2740yesN/A
Q9CY21WBS22_MOUSE2, ., 1, ., 1, ., -0.58330.55380.2562yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG1541|consensus270 100.0
TIGR00438188 rrmJ cell division protein FtsJ. 88.06
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 86.08
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 83.69
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 83.24
PF1258987 WBS_methylT: Methyltransferase involved in William 81.8
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 81.29
>KOG1541|consensus Back     alignment and domain information
Probab=100.00  E-value=2.6e-39  Score=267.35  Aligned_cols=87  Identities=57%  Similarity=0.858  Sum_probs=80.6

Q ss_pred             ccchhhHHHHHHH-------------HHHHHHHhhcccCceeEEEEccCCHHHHHHHHHHHHHccccceEEeeCCCCCCc
Q psy17721          6 LRSISKAQFSLKQ-------------ISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVVDYPHSTKA   72 (130)
Q Consensus         6 ~~svs~~qw~l~~-------------~FF~SLY~~L~rGaRAVlQFYPEn~~Q~EmIt~aA~kaGF~GGlVVD~PnS~KA   72 (130)
                      ..|||+.|| |||             +||+|||.||+||+||||||||||++|+|||+.+||+|||+||||||||+|+|+
T Consensus       116 ~ISISAvQW-LcnA~~s~~~P~~Rl~~FF~tLy~~l~rg~raV~QfYpen~~q~d~i~~~a~~aGF~GGlvVd~Pes~k~  194 (270)
T KOG1541|consen  116 VISISAVQW-LCNADKSLHVPKKRLLRFFGTLYSCLKRGARAVLQFYPENEAQIDMIMQQAMKAGFGGGLVVDWPESTKN  194 (270)
T ss_pred             EEEeeeeee-ecccCccccChHHHHHHHhhhhhhhhccCceeEEEecccchHHHHHHHHHHHhhccCCceeeeccccccc
Confidence            359999999 885             899999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEEEEEeCCCCCCCCccCCCC
Q psy17721         73 KKFFLVLMTGGDLPLPPALGEGE   95 (130)
Q Consensus        73 KK~yLvL~~G~~~~lp~~l~~~~   95 (130)
                      ||+||||++|+.  +|+.++.++
T Consensus       195 kK~yLVL~~g~~--~~~~l~~~~  215 (270)
T KOG1541|consen  195 KKYYLVLMTGGV--VPRALTAGG  215 (270)
T ss_pred             ceeEEEEecCCc--ccccccCCc
Confidence            999999999976  677775443



>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF12589 WBS_methylT: Methyltransferase involved in Williams-Beuren syndrome; InterPro: IPR022238 This domain family is found in eukaryotes, and is typically between 72 and 83 amino acids in length Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 93.29
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 92.09
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 90.76
3lcc_A235 Putative methyl chloride transferase; halide methy 89.61
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 89.26
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 86.51
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 85.82
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 85.42
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 85.21
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 84.81
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 84.5
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 84.1
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 83.59
3lpm_A259 Putative methyltransferase; structural genomics, p 82.41
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 82.05
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 82.04
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 81.91
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 81.23
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 80.67
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
Probab=93.29  E-value=0.28  Score=36.14  Aligned_cols=62  Identities=5%  Similarity=-0.059  Sum_probs=45.6

Q ss_pred             HHHHHHHHhhcccCceeEEEEccCCHHHHHHHHHHHHHccccceEEe--eCCCCCCcceEEEEEEe
Q psy17721         18 QISHLRLFTRLSRTARAVFQFYPENSAQIELVTSQAMRAGFYGGLVV--DYPHSTKAKKFFLVLMT   81 (130)
Q Consensus        18 ~~FF~SLY~~L~rGaRAVlQFYPEn~~Q~EmIt~aA~kaGF~GGlVV--D~PnS~KAKK~yLvL~~   81 (130)
                      +.++..++..|++||+.++..-+...+.++.+.....++||.---+.  ..|..  ....++++..
T Consensus       154 ~~~l~~~~~~LkpgG~l~~~~g~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~--~~~~~l~~~~  217 (240)
T 1xdz_A          154 SVLSELCLPLVKKNGLFVALKAASAEEELNAGKKAITTLGGELENIHSFKLPIE--ESDRNIMVIR  217 (240)
T ss_dssp             HHHHHHHGGGEEEEEEEEEEECC-CHHHHHHHHHHHHHTTEEEEEEEEEECTTT--CCEEEEEEEE
T ss_pred             HHHHHHHHHhcCCCCEEEEEeCCCchHHHHHHHHHHHHcCCeEeEEEEEecCCC--CCceEEEEEE
Confidence            57899999999999999998777777788888888889999754443  44544  4455555543



>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 92.32
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 88.53
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 88.0
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 81.51
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 81.23
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: Methoxy mycolic acid synthase 4, Mma4
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=92.32  E-value=0.087  Score=39.66  Aligned_cols=21  Identities=19%  Similarity=0.121  Sum_probs=19.8

Q ss_pred             HHHHHHHHhhcccCceeEEEE
Q psy17721         18 QISHLRLFTRLSRTARAVFQF   38 (130)
Q Consensus        18 ~~FF~SLY~~L~rGaRAVlQF   38 (130)
                      +.||+.+++.|++||++|+|.
T Consensus       136 ~~~f~~i~~~LkpgG~~~i~~  156 (280)
T d2fk8a1         136 DDFFKRCFNIMPADGRMTVQS  156 (280)
T ss_dssp             HHHHHHHHHHSCTTCEEEEEE
T ss_pred             HHHHHHHHhccCCCceEEEEE
Confidence            689999999999999999994



>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure