Diaphorina citri psyllid: psy17732

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------

MIRKWADDGGFSWDDVEAIEEPKAQRSLPPKQLRVLAGAPAEKKPEETQARDIGAQKDSEIQALHFPKKRDIKKTREFHHWVRPTRLQYRYNYDYAHNYYDDVIHYLNSKSQGGHVTELPRPQTWAERALRTYTKDWPDTATYEKTKADEELLQKLRFSGKFYAQHSKEFYNRKYRDVLYAYITHW

ccccccccccccccccHHccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHccc

********GGFSWD*****************************************************KKRDIKKTREFHHWVRPTRLQYRYNYDYAHNYYDDVIHYLNSKSQGGHVTELPRPQTWAERALRTYTKDWPDTATYEKTKADEELLQKLRFSGKFYAQHSKEFYNRKYRDVLYAYITHW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIRKWADDGGFSWDDVEAIEEPKAQRSLPPKQLRVLAGAPAEKKPEETQARDIGAQKDSEIQALHFPKKRDIKKTREFHHWVRPTRLQYRYNYDYAHNYYDDVIHYLNSKSQGGHVTELPRPQTWAERALRTYTKDWPDTATYEKTKADEELLQKLRFSGKFYAQHSKEFYNRKYRDVLYAYITHW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005863 [CC]	striated muscle myosin thick filament	probable	GO:0015629, GO:0030016, GO:0030017, GO:0043229, GO:0043228, GO:0044430, GO:0043226, GO:0005856, GO:0044446, GO:0032982, GO:0005859, GO:0016459, GO:0005737, GO:0044424, GO:0043234, GO:0036379, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016460, GO:0043292, GO:0044422, GO:0044449
GO:0031672 [CC]	A band	probable	GO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0030241 [BP]	skeletal muscle myosin thick filament assembly	probable	GO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0034622, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0071688, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0014866, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0030154, GO:0044763, GO:0009987, GO:0042692
GO:0014703 [BP]	oscillatory muscle contraction	probable	GO:0006941, GO:0050881, GO:0032501, GO:0044707, GO:0006936, GO:0050879, GO:0003010, GO:0003012, GO:0008150, GO:0044699, GO:0003009, GO:0003008
GO:0007527 [BP]	adult somatic muscle development	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0061061, GO:0007525, GO:0044699
GO:0045214 [BP]	sarcomere organization	probable	GO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692

Prediction of Enzyme Commission Number

No confident prediction of EC number!