Diaphorina citri psyllid: psy17733

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39

MLLCSQEWQTSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHAELLSHAMKDHIVRVANEAEFILNRMRADDVLKHAEFESHCAQTLQERRDEERLCDHLISAARRRDQGTAGRILDKVSNILSNKHGAWAYNEAARTQEFWKLDSWEDDARRRKRFVRNPRGTSHPNATLEKVAQKEVPEDAIAHANQEFHAQVAVVSQSSQANGANTCSELMDDSELIEGEVAVVSQSSQANGANTCSELMDDSELIEGGGDIDIDLTGPVNISTRARLISPGVSAQGTLSITSTELYFEVDEDCPDFRNTDPERSVISGVVVSRTPDLEFGGPVNISTRARLISPGVSAQGTLSITSTELYFEVDEDCPDFRNTDPE

ccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccHHHHcccccccccccccHHcHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHcccHHHHccccccccccccccccccHHHHcccccccccccccEEEECcccccccccccccEEEEEEEEEEEEEcccccccccccccccCEHHHHccccccccccccEEEcccccEEcccEEEccEEEEEccEEEEEEccccccccccccc

******EWQTSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHAELLSHAMKDHIVRVANEAEFILNRMRADDVLKHAEFESHCAQT********RLCDHLISAARRRDQGTAGRILDKVSNILSNKHGAWAYNEAARTQEFWKLDSWEDDARRRKRFVRNPRGTSH*********************************************************************************LIEGGGDIDIDLTGPVNISTRARLISPGVSAQGTLSITSTELYFEVDEDCPDFRNTDPERSVISGVVVSRTPDLEFGGPVNISTRARLISPGVSAQGTLSITSTELYFEVDEDCP********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Neurobeachin	Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. Required for correct retinal pattern formation and may function in cell fate determination through its interactions with the EGFR and Notch signaling pathways.	confident	Q9W4E2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T77, chain A
Confidence level:very confident
Coverage over the Query: 279-329
View the alignment between query and template
View the model in PyMOL

Template: 1MI1, chain A
Confidence level:probable
Coverage over the Query: 279-322
View the alignment between query and template
View the model in PyMOL