Diaphorina citri psyllid: psy17734

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620------
MSQAKIAVSVGLEYPTCYNIQSQIESLAAECFDYAVLPLVHPRFARHKDVDRYRVFGLPEAQVQSLSSICPQWLKLIVCDIQCKLKDFESKYVERRDHAKDLLHQELEYITYLGIPFIVVSLDQPDFCNFARTLYAHSEKNMSYTAWIKVPIRPVDTSMLRQQEEEPSSQDTWRWWNMFRSVTNYHSKFELALEINGDICDDHELTRWLGEPLRCVFIPTHVFQTNKAGYPVLNASLANFIKKILEKNLQVVIQGVNRHQSYLHYVQYMQYLKKSSHSDDPLSMAAQDFEDYLQFPLQPLANDLSSFTYEVFEKDPIKYIRYQEAVQQALLDRVSPEQADTVVTTIMVVGAGRGPLVTASLNAAKEANRKVRVYAVEKNMSAVVGLKYKKEEQWAQSDVTIVSEDMRTWNAPEKADIMVSELLGSFGDNELSPECLYAAQKYLKEDGISIPYNYTSYIAPIMSHKLFTQVKSSMIKEHQHPLYRFEQPYVVYQRNKYNIAPPQPCFTFVHPSEDKDPDNSRYTKATFIAEQDSVLHGIAGYFDTFLYKDINLSIHPDTLSPGLISWFPVLFPIHEPIQLKTNDEIEVHFWRLCDNVKVWYEWLVTKPTPSPIYNLDGRSYKMMKIL
ccccccEEEEcccccccccHHHHHHHHHHccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEECcccccHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEccccccccccccHHHHHHHHHHcccccCECccccCEEEECcccHHHHHHHHHHcccccccccccccccEEEEEcccccccccccEEEccccccccccccCEEEEEEEEECccEEEEEEEEEEEEEEcccccccccccccccccccccCEEccccccEEEccccEEEEEEEEEEcccEEEEEEEEEcccccccccccccEEEEEEcc
*****IAVSVGLEYPTCYNIQSQIESLAAECFDYAVLPLVHPRFAR*******RVFGLPEAQVQSLSSICPQWLKLIVCDIQCKLKDFESKYVERRDHAKDLLHQELEYITYLGIPFIVVSLDQPDFCNFARTLYAHSEKNMSYTAWIKVPIRPV***********PSSQDTWRWWNMFRSVTNYHSKFELALEINGDICDDHELTRWLGEPLRCVFIPTHVFQTNKAGYPVLNASLANFIKKILEKNLQVVIQGVNRHQSYLHYVQYMQYLKKSSH*******A*QDFEDYLQFPLQPLANDLSSFTYEVFEKDPIKYIRYQEAVQQALLDRVSPEQADTVVTTIMVVGAGRGPLVTASLNAAKEANRKVRVYAVEKNMSAVVGLKYKKEEQWAQSDVTIVSEDMRTWNAPEKADIMVSELLGSFGDNELSPECLYAAQKYLKEDGISIPYNYTSYIAPIMSHKLFTQVKSSMIKEHQHPLYRFEQPYVVYQRNKYNIAPPQPCFTFVHPSEDKDPDNSRYTKATFIAEQDSVLHGIAGYFDTFLYKDINLSIHPDTLSPGLISWFPVLFPIHEPIQLKTNDEIEVHFWRLCDNVKVWYEWLVTKPTPSPIYNLDGRSYKMMKIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQAKIAVSVGLEYPTCYNIQSQIESLAAECFDYAVLPLVHPRFARHKDVDRYRVFGLPEAQVQSLSSICPQWLKLIVCDIQCKLKDFESKYVERRDHAKDLLHQELEYITYLGIPFIVVSLDQPDFCNFARTLYAHSEKNMSYTAWIKVPIRPVDTSMLRQQEEEPSSQDTWRWWNMFRSVTNYHSKFELALEINGDICDDHELTRWLGEPLRCVFIPTHVFQTNKAGYPVLNASLANFIKKILEKNLQVVIQGVNRHQSYLHYVQYMQYLKKSSHSDDPLSMAAQDFEDYLQFPLQPLANDLSSFTYEVFEKDPIKYIRYQEAVQQALLDRVSPEQADTVVTTIMVVGAGRGPLVTASLNAAKEANRKVRVYAVEKNMSAVVGLKYKKEEQWAQSDVTIVSEDMRTWNAPEKADIMVSELLGSFGDNELSPECLYAAQKYLKEDGISIPYNYTSYIAPIMSHKLFTQVKSSMIKEHQHPLYRFEQPYVVYQRNKYNIAPPQPCFTFVHPSEDKDPDNSRYTKATFIAEQDSVLHGIAGYFDTFLYKDINLSIHPDTLSPGLISWFPVLFPIHEPIQLKTNDEIEVHFWRLCDNVKVWYEWLVTKPTPSPIYNLDGRSYKMMKIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein arginine N-methyltransferase 5 Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10. Attenuates EGF signaling through the MAPK1/MAPK3 pathway acting at 2 levels. First, monomethylates EGFR; this enhances EGFR 'Tyr-1197' phosphorylation and PTPN6 recruitment, eventually leading to reduced SOS1 phosphorylation (By similarity). Second, methylates RAF1 and probably BRAF, hence destabilizing these 2 signaling proteins and reducing their catalytic activity. Required for induction of E-selectin and VCAM-1, on the endothelial cells surface at sites of inflammation (By similarity). Methylates HOXA9.confidentQ8CIG8
Protein arginine N-methyltransferase 5 Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10. Attenuates EGF signaling through the MAPK1/MAPK3 pathway acting at 2 levels. First, monomethylates EGFR; this enhances EGFR 'Tyr-1197' phosphorylation and PTPN6 recruitment, eventually leading to reduced SOS1 phosphorylation. Second, methylates RAF1 and probably BRAF, hence destabilizing these 2 signaling proteins and reducing their catalytic activity. Required for induction of E-selectin and VCAM-1, on the endothelial cells surface at sites of inflammation. Methylates HOXA9.confidentO14744
Protein arginine N-methyltransferase 1.5 Methylates arginine residues of myelin basic protein (MBP) in vitro. Methylates symmetrically histone H4 of the FLC chromatin to form H4R3me2s, which in turn suppresses FLC expression to induce flowering.confidentQ8GWT4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0019918 [BP]peptidyl-arginine methylation, to symmetrical-dimethyl arginineprobableGO:0006479, GO:0008213, GO:0035246, GO:0035247, GO:0044267, GO:0044260, GO:0018216, GO:0018193, GO:0071704, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044238, GO:0019538, GO:0044237, GO:0043170, GO:0018195, GO:0043414
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007088 [BP]regulation of mitosisprobableGO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0008469 [MF]histone-arginine N-methyltransferase activityprobableGO:0016274, GO:0042054, GO:0016273, GO:0003824, GO:0008757, GO:0016740, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0043021 [MF]ribonucleoprotein complex bindingprobableGO:0003674, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0007318 [BP]pole plasm protein localizationprobableGO:0008105, GO:0008104, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0048610, GO:0000578, GO:0009798, GO:0007308, GO:0007309, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0009948, GO:0007028, GO:0016043, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0022607, GO:0009880, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0008595, GO:0007315, GO:0007314, GO:0044763, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0044767, GO:0044702, GO:0009952, GO:0044707, GO:0003006, GO:0048856, GO:0044085, GO:0048869, GO:0008150
GO:0035243 [MF]protein-arginine omega-N symmetric methyltransferase activityprobableGO:0016274, GO:0016273, GO:0003824, GO:0008757, GO:0016740, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0034660 [BP]ncRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0010220 [BP]positive regulation of vernalization responseprobableGO:0080134, GO:0048584, GO:0048583, GO:0010219, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0030719 [BP]P granule organizationprobableGO:0022607, GO:0009994, GO:0043933, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0048610, GO:0000578, GO:0009798, GO:0007308, GO:0007309, GO:0035282, GO:0010259, GO:0007275, GO:0071840, GO:0048609, GO:0007389, GO:0071826, GO:0007276, GO:0000003, GO:0009948, GO:0007028, GO:0016043, GO:0022414, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0008595, GO:0007315, GO:0007314, GO:0044763, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0006996, GO:0044767, GO:0044702, GO:0009952, GO:0044707, GO:0003006, GO:0048856, GO:0044085, GO:0048869, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008298 [BP]intracellular mRNA localizationprobableGO:0006403, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0016570 [BP]histone modificationprobableGO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0016043, GO:0071704, GO:0071840, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0042118 [BP]endothelial cell activationprobableGO:0008150, GO:0001775, GO:0009987, GO:0044763, GO:0044699
GO:0030587 [BP]sorocarp developmentprobableGO:0030582, GO:0061458, GO:0019954, GO:0009991, GO:0075259, GO:0042594, GO:0007275, GO:0044699, GO:0000003, GO:0048513, GO:0032502, GO:0032501, GO:0048608, GO:0022414, GO:0006950, GO:0008150, GO:0055084, GO:0009605, GO:0044707, GO:0003006, GO:0050896, GO:0048856, GO:0031667, GO:0048731
GO:0051286 [CC]cell tipprobableGO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0000387 [BP]spliceosomal snRNP assemblyprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0048742 [BP]regulation of skeletal muscle fiber developmentprobableGO:1901861, GO:0016202, GO:0051239, GO:0050793, GO:0048634, GO:0060284, GO:0050794, GO:0008150, GO:0051153, GO:0045595, GO:0065007, GO:2000026, GO:0051147, GO:0048641, GO:0050789

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.125Transferred entry: 2.1.1.124, 2.1.1.125 and 2.1.1.126.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GQB, chain A
Confidence level:very confident
Coverage over the Query: 7-624
View the alignment between query and template
View the model in PyMOL