Psyllid ID: psy1773


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
RFAVKKLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
ccccccHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccHHHHcccccccHHHHcccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHcccccccccc
cccccHHHHHcccccccccccccccccEEccccccEEEEcccccccccEccccccEEccccccEEEEEEEEcccccccEEEccccccccEccccHHHHHHHHccccccccccccccccccccccEccccHHHHHHHHcccccccccEEcccccccEccccHHHHHHHHcccccccEcccccccccEccccHHHEHEHHcccccccccccHHHccccEccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccEEEEcccccccEccccHHHHHHHHHccccccEEcccccccccEccccHHHHHHHHcccccccEEEEcccccccEccccHHHHHHHHHccccccc
RFAVKKLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLginkeyfisstggknskkqqlwscpivncnftsvnlNTFKIHLLkhfdkrpfkcklttanntpcmwgffskhkLLRHmtshdedkkcypcdqkncnkrfTTLSNLKMhmvrhgkpltlcceelgcgrkfqtMKQYSTHLkehsnvsapymcdykgcgksFYLMASLKShqrvhvtnpedlvckgcgkqfkvpcrlREHYKAVHestknfkctydgcklLFSTKSALKrhnkskhlnmrmfpcplvtcgksflrSEHLQEHMLqhnenkpkftcpyqdclmSYVAKSSLYAHLKhvhstnkit
rfavkkllefaqdtddvsarnVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDedkkcypcdqknCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVhestknfkctydGCKLLFSTKSALKRHNKskhlnmrmfpCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHlkhvhstnkit
RFAVKKLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
******LLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISSTGGK**KKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHV*******
*FA**KLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEY*ISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTN*I*
RFAVKKLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISS*********QLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKH********
**************DDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAH*KHVH******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RFAVKKLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYEDEEDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
A2CE44 873 Zinc finger X-linked prot yes N/A 0.729 0.300 0.399 4e-47
P98169 803 Zinc finger X-linked prot yes N/A 0.729 0.326 0.395 1e-45
Q2QGD7 858 Zinc finger protein ZXDC no N/A 0.743 0.311 0.383 2e-45
Q8C8V1 858 Zinc finger protein ZXDC no N/A 0.743 0.311 0.381 2e-45
P98168 799 Zinc finger X-linked prot yes N/A 0.729 0.327 0.392 1e-44
Q8VHT7364 Transcription factor IIIA no N/A 0.813 0.802 0.301 3e-26
P34694339 Transcription factor IIIA N/A N/A 0.685 0.725 0.303 4e-26
Q8VHT8363 Transcription factor IIIA no N/A 0.791 0.782 0.303 3e-25
P03001366 Transcription factor IIIA N/A N/A 0.685 0.672 0.303 2e-24
P17842339 Transcription factor IIIA N/A N/A 0.679 0.719 0.315 5e-24
>sp|A2CE44|ZXDAB_MOUSE Zinc finger X-linked protein ZXDA/ZXDB OS=Mus musculus GN=Zxda PE=2 SV=1 Back     alignment and function desciption
 Score =  189 bits (479), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 149/278 (53%), Gaps = 16/278 (5%)

Query: 78  LWSCPIVNCNFTSVNLNTFKIHLLKHFD---KRPFKCKLTTANNTPCMWGFFSKHKLLRH 134
           L+ CP   C  T    +  K+HLL H     +RPFKC L+      C W F + +KL RH
Sbjct: 339 LYLCPEAQCGQTFAKKHQLKVHLLTHSSSQGQRPFKCPLSG-----CGWTFTTSYKLKRH 393

Query: 135 MTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYST 194
           + SHD+ +  + C  + C K FTT+ NLK HM  H +  +  CE   C   F T  + ST
Sbjct: 394 LQSHDKLRP-FGCPVQGCGKSFTTVYNLKAHMKGHEQENSFKCEV--CEESFPTQAKLST 450

Query: 195 HLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVC--KGCGKQFKVPCRL 252
           H + H     PY C + GC K+F  +++L SH R H    E   C   GC KQ+   CRL
Sbjct: 451 HQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFACSFPGCSKQYDKACRL 510

Query: 253 REHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSE 312
           + H ++ H   + F C +DGC   F++ S L RH K KH + R F CP+  CGKSF R+E
Sbjct: 511 KIHLRS-HTGERPFLCDFDGCGWNFTSMSKLLRH-KRKHEDDRRFTCPVEGCGKSFTRAE 568

Query: 313 HLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK 350
           HL+ H + H   KP F CP + C   + A+SSLY H K
Sbjct: 569 HLKGHSITHLGTKP-FVCPVEGCCARFSARSSLYIHSK 605




Cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Mus musculus (taxid: 10090)
>sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 Back     alignment and function description
>sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 Back     alignment and function description
>sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 Back     alignment and function description
>sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 Back     alignment and function description
>sp|Q8VHT7|TF3A_MOUSE Transcription factor IIIA OS=Mus musculus GN=Gtf3a PE=2 SV=2 Back     alignment and function description
>sp|P34694|TF3A_ANAAE Transcription factor IIIA OS=Anaxyrus americanus GN=gtf3a PE=2 SV=1 Back     alignment and function description
>sp|Q8VHT8|TF3A_RAT Transcription factor IIIA OS=Rattus norvegicus GN=Gtf3a PE=2 SV=2 Back     alignment and function description
>sp|P03001|TF3A_XENLA Transcription factor IIIA OS=Xenopus laevis GN=gtf3a PE=1 SV=2 Back     alignment and function description
>sp|P17842|TF3A_XENBO Transcription factor IIIA OS=Xenopus borealis GN=gtf3a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
328788295 1033 PREDICTED: hypothetical protein LOC10057 0.807 0.280 0.421 3e-57
322788189 1004 hypothetical protein SINV_08318 [Solenop 0.807 0.288 0.424 6e-57
332027659 997 Zinc finger X-linked protein ZXDB [Acrom 0.807 0.290 0.424 7e-57
340714417 1026 PREDICTED: hypothetical protein LOC10065 0.807 0.282 0.418 2e-56
350399130 1026 PREDICTED: hypothetical protein LOC10074 0.807 0.282 0.418 2e-56
307176119 945 Zinc finger X-linked protein ZXDB [Campo 0.807 0.306 0.421 1e-55
383863735 1034 PREDICTED: uncharacterized protein LOC10 0.807 0.280 0.415 5e-55
126336475 1087 PREDICTED: zinc finger protein ZXDC-like 0.729 0.241 0.395 5e-48
427792249 591 Putative zxd family zinc finger c, parti 0.740 0.450 0.382 8e-48
427790989 604 Putative zxd family zinc finger c, parti 0.740 0.440 0.382 9e-48
>gi|328788295|ref|XP_003251098.1| PREDICTED: hypothetical protein LOC100577295 [Apis mellifera] Back     alignment and taxonomy information
 Score =  228 bits (581), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 172/306 (56%), Gaps = 16/306 (5%)

Query: 47  EDAITEALQSLGINKEYFISSTGGKNSKKQQLWSCPIVNCNFTSVNLNTFKIHLLKHFDK 106
           E  I+ AL+ LGI  +     +  +N K   +W CP  +CN     L   K HLL H+  
Sbjct: 448 EMVISNALEELGITDDNLQPVSVNENGK---IWLCPRDDCNRQFSKLYALKGHLLAHYGV 504

Query: 107 RPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHM 166
           RPFKC         C W F+S+ KL RH  +H + +K Y C+ + CN+RFTT+ NL  H 
Sbjct: 505 RPFKCDFEG-----CAWAFYSEFKLKRHKETHLK-RKDYVCEVEGCNRRFTTIYNLWSHA 558

Query: 167 VRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSH 226
             H +P  + C+   C  KFQT +    H+K H    APY+C ++GCGK +Y   +L SH
Sbjct: 559 KLHSRPNRILCQVPDCQEKFQTKRALELHMKTHDQSHAPYICKHEGCGKRYYSSNALTSH 618

Query: 227 QRVHVTNPEDLVCK--GCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALK 284
           QR H     D+ C   GCGK F  PCRL+ H ++ H   K + CT+ GC+  FS+ S LK
Sbjct: 619 QRCHSYKEVDVKCSWPGCGKVFDKPCRLKAHIRS-HTGCKPYLCTFQGCQWAFSSSSKLK 677

Query: 285 RHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSS 344
           RH K KH N R F C + +CGK+F+RSEHL+EH L H E +  F C    C   + AKSS
Sbjct: 678 RHQK-KHTNERKFVCDVPSCGKAFMRSEHLKEHRLTHKEGR-YFQCCI--CNAKFSAKSS 733

Query: 345 LYAHLK 350
           LY H+K
Sbjct: 734 LYVHIK 739




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322788189|gb|EFZ13971.1| hypothetical protein SINV_08318 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332027659|gb|EGI67727.1| Zinc finger X-linked protein ZXDB [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340714417|ref|XP_003395725.1| PREDICTED: hypothetical protein LOC100650640 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350399130|ref|XP_003485431.1| PREDICTED: hypothetical protein LOC100745564 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307176119|gb|EFN65817.1| Zinc finger X-linked protein ZXDB [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383863735|ref|XP_003707335.1| PREDICTED: uncharacterized protein LOC100877567 [Megachile rotundata] Back     alignment and taxonomy information
>gi|126336475|ref|XP_001377050.1| PREDICTED: zinc finger protein ZXDC-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|427792249|gb|JAA61576.1| Putative zxd family zinc finger c, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427790989|gb|JAA60946.1| Putative zxd family zinc finger c, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
RGD|1563355 583 Zxdb "zinc finger, X-linked, d 0.729 0.449 0.399 2.4e-51
RGD|1585677 583 LOC683516 "similar to Zinc fin 0.729 0.449 0.399 2.4e-51
RGD|1585685 583 LOC683508 "similar to Zinc fin 0.729 0.449 0.399 2.4e-51
MGI|MGI:3694898 873 Zxdb "zinc finger, X-linked, d 0.729 0.300 0.399 1.1e-50
UNIPROTKB|E2R2S7 779 ZXDB "Uncharacterized protein" 0.746 0.344 0.389 4.5e-50
UNIPROTKB|F1MWD7 749 ZXDC "Uncharacterized protein" 0.727 0.348 0.389 1e-49
UNIPROTKB|G3MYH0 760 ZXDC "Uncharacterized protein" 0.727 0.343 0.389 1.2e-49
UNIPROTKB|F6XMD6 904 ZXDB "Uncharacterized protein" 0.746 0.296 0.389 1.3e-49
UNIPROTKB|P98169 803 ZXDB "Zinc finger X-linked pro 0.746 0.333 0.389 1.7e-49
UNIPROTKB|G3X7S5 814 ZXDB "Uncharacterized protein" 0.746 0.329 0.389 1.9e-49
RGD|1563355 Zxdb "zinc finger, X-linked, duplicated B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 533 (192.7 bits), Expect = 2.4e-51, P = 2.4e-51
 Identities = 111/278 (39%), Positives = 149/278 (53%)

Query:    78 LWSCPIVNCNFTSVNLNTFKIHLLKHFD---KRPFKCKLTTANNTPCMWGFFSKHKLLRH 134
             L+ CP   C  T    +  K+HLL H     +RPFKC L+      C W F + +KL RH
Sbjct:    46 LYLCPEAQCGQTFAKKHQLKVHLLTHSSSQGQRPFKCPLSG-----CGWTFTTSYKLKRH 100

Query:   135 MTSHDEDKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYST 194
             + SHD+ +  + C  + C K FTT+ NLK HM  H +  +  CE   C   F T  + ST
Sbjct:   101 LQSHDKLRP-FGCPVEGCGKSFTTVYNLKAHMKGHEQENSFKCEV--CEESFPTQAKLST 157

Query:   195 HLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCK--GCGKQFKVPCRL 252
             H + H     PY C + GC K+F  +++L SH R H    E   C   GC KQ+   CRL
Sbjct:   158 HQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFACSFPGCSKQYDKACRL 217

Query:   253 REHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSE 312
             + H ++ H   + F C +DGC   F++ S L RH K KH + R F CP+  CGKSF R+E
Sbjct:   218 KIHLRS-HTGERPFLCDFDGCGWNFTSMSKLLRH-KRKHEDDRRFTCPVEGCGKSFTRAE 275

Query:   313 HLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK 350
             HL+ H + H   KP F CP + C   + A+SSLY H K
Sbjct:   276 HLKGHSITHLGTKP-FVCPVEGCCARFSARSSLYIHSK 312


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
RGD|1585677 LOC683516 "similar to Zinc finger X-linked protein ZXDB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1585685 LOC683508 "similar to Zinc finger X-linked protein ZXDB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:3694898 Zxdb "zinc finger, X-linked, duplicated B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2S7 ZXDB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWD7 ZXDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYH0 ZXDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6XMD6 ZXDB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P98169 ZXDB "Zinc finger X-linked protein ZXDB" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7S5 ZXDB "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
pfam01756186 pfam01756, ACOX, Acyl-CoA oxidase 4e-07
cd01150610 cd01150, AXO, Peroxisomal acyl-CoA oxidase 7e-05
>gnl|CDD|201956 pfam01756, ACOX, Acyl-CoA oxidase Back     alignment and domain information
 Score = 49.1 bits (118), Expect = 4e-07
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 1   RFAVKKLLEFAQDTDDVSARNVLTKLAVLYSTWSLEKHLATFYED---EEDAITEALQSL 57
            + +K   E   +  D + + VLT+LA LY+ W LEKH   F        D I +  + +
Sbjct: 58  LYLLKAFYERINEIADPALKPVLTRLAKLYALWILEKHSGDFLRFGYLSPDQIDQVREQI 117


This is a family of Acyl-CoA oxidases EC:1.3.3.6. Acyl-coA oxidase converts acyl-CoA into trans-2- enoyl-CoA. Length = 186

>gnl|CDD|173839 cd01150, AXO, Peroxisomal acyl-CoA oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
KOG3608|consensus467 99.97
KOG3608|consensus467 99.96
KOG1074|consensus958 99.95
KOG2462|consensus279 99.95
KOG2462|consensus279 99.93
KOG3623|consensus 1007 99.86
KOG3623|consensus1007 99.85
KOG1074|consensus958 99.8
KOG3576|consensus267 99.68
KOG3576|consensus267 99.61
PHA00733128 hypothetical protein 99.13
PLN03086567 PRLI-interacting factor K; Provisional 99.08
PLN03086567 PRLI-interacting factor K; Provisional 99.07
PHA00733128 hypothetical protein 99.04
PHA0276855 hypothetical protein; Provisional 98.83
PHA0276855 hypothetical protein; Provisional 98.69
KOG3993|consensus500 98.59
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.59
KOG3993|consensus500 98.37
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.36
PHA0061644 hypothetical protein 98.27
PHA0061644 hypothetical protein 98.23
PHA0073279 hypothetical protein 98.2
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.14
PHA0073279 hypothetical protein 98.03
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.75
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.71
COG5189423 SFP1 Putative transcriptional repressor regulating 97.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.69
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.6
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.53
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.49
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.46
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.35
COG5189423 SFP1 Putative transcriptional repressor regulating 97.34
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.92
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.86
KOG4173|consensus253 96.69
smart0035526 ZnF_C2H2 zinc finger. 96.68
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.35
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.3
smart0035526 ZnF_C2H2 zinc finger. 96.28
KOG4173|consensus253 96.27
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.14
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.04
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.99
KOG2231|consensus 669 95.83
COG5048 467 FOG: Zn-finger [General function prediction only] 95.72
KOG2231|consensus 669 95.62
KOG1146|consensus 1406 95.56
KOG1146|consensus 1406 95.24
COG5048467 FOG: Zn-finger [General function prediction only] 95.23
KOG2482|consensus423 95.13
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.07
PRK04860160 hypothetical protein; Provisional 95.05
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.81
PRK04860160 hypothetical protein; Provisional 94.18
KOG2482|consensus423 93.7
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.12
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.93
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.62
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.66
KOG4377|consensus480 87.51
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 86.93
KOG2785|consensus 390 85.86
COG404965 Uncharacterized protein containing archaeal-type C 85.56
COG404965 Uncharacterized protein containing archaeal-type C 84.32
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 83.49
KOG2893|consensus 341 82.55
KOG2785|consensus 390 81.86
KOG2893|consensus 341 81.64
>KOG3608|consensus Back     alignment and domain information
Probab=99.97  E-value=4.5e-31  Score=217.82  Aligned_cols=264  Identities=24%  Similarity=0.436  Sum_probs=226.7

Q ss_pred             eeeccCCCCCCcccC-hhHHHhHHhhhC-----------------CCCccccccCC------------CCCccchhhccc
Q psy1773          78 LWSCPIVNCNFTSVN-LNTFKIHLLKHF-----------------DKRPFKCKLTT------------ANNTPCMWGFFS  127 (359)
Q Consensus        78 ~~~C~~~~C~~~~~~-~~~l~~H~~~h~-----------------~~~~~~C~~~~------------~~~~~C~~~f~~  127 (359)
                      .++|.|..|++...+ ...|.+|.-.|-                 +..+-.|++-.            +.|.+|+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            589999999998877 578999976552                 11111111111            124679999999


Q ss_pred             HHHHHhhhhhcCC------------CCCccccCCCccchhhcCHHHHHHHHHHhCCCCccccccccchhhcCChHHHHHH
Q psy1773         128 KHKLLRHMTSHDE------------DKKCYPCDQKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTH  195 (359)
Q Consensus       128 ~~~l~~H~~~~~~------------~~~~~~c~c~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H  195 (359)
                      ...+..|+..|..            ++..+.|.|..|.+.+.+++.|+.|++.|++++...|..  |+..|.++..|..|
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~--Cg~~F~~~tkl~DH  226 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPH--CGELFRTKTKLFDH  226 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecch--HHHHhccccHHHHH
Confidence            9999999877642            225689999999999999999999999999999999999  99999999999999


Q ss_pred             HHHcCC-CCCCccccCCCCCccccChHHHHHHhhhhcCCCCccccCCcCccCCChHHHHHHHHHHccCCCccccccCCcC
Q psy1773         196 LKEHSN-VSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLVCKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCK  274 (359)
Q Consensus       196 ~~~h~~-~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~~~C~  274 (359)
                      .+..+. ...+|.|..  |.|.|.+...|..|+..|.   .-|+|+.|+.+....++|..|++..|+..+||+|  +.|+
T Consensus       227 ~rRqt~l~~n~fqC~~--C~KrFaTeklL~~Hv~rHv---n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKC--d~Cd  299 (467)
T KOG3608|consen  227 LRRQTELNTNSFQCAQ--CFKRFATEKLLKSHVVRHV---NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKC--DECD  299 (467)
T ss_pred             HHhhhhhcCCchHHHH--HHHHHhHHHHHHHHHHHhh---hcccccccccCCCChHHHHHHHHhhhccCCCccc--cchh
Confidence            876542 246899986  9999999999999999994   4599999999999999999999999999999999  4699


Q ss_pred             ccccChHhhhccccccccCCcccCCCCCCcCcccCChHHHHHHHHhhc-CC-CCceeccCCCccccccchhhHHHHHhhh
Q psy1773         275 LLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHMLQHN-EN-KPKFTCPYQDCLMSYVAKSSLYAHLKHV  352 (359)
Q Consensus       275 ~~f~~~~~l~~H~~~~H~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~-~~-~~~~~C~~~~C~~~f~~~~~l~~H~~~h  352 (359)
                      +.|.+.+.|.+|.. .|+ +..|.|..+.|..+|.+...+.+|++.++ |. .++|.|-.  |++.|++..+|.+|+...
T Consensus       300 ~~c~~esdL~kH~~-~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~--Cdr~ft~G~~L~~HL~kk  375 (467)
T KOG3608|consen  300 TRCVRESDLAKHVQ-VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHC--CDRFFTSGKSLSAHLMKK  375 (467)
T ss_pred             hhhccHHHHHHHHH-hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeec--chhhhccchhHHHHHHHh
Confidence            99999999999998 688 67799999899999999999999998877 33 33799999  999999999999999988


Q ss_pred             cC
Q psy1773         353 HS  354 (359)
Q Consensus       353 h~  354 (359)
                      |+
T Consensus       376 H~  377 (467)
T KOG3608|consen  376 HG  377 (467)
T ss_pred             hc
Confidence            85



>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4377|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-15
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 7e-13
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-12
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-13
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 6e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 2e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-05
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 7e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-04
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 5e-04
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 5e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-04
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 57/174 (32%), Positives = 80/174 (45%), Gaps = 11/174 (6%) Query: 79 WSCPIVNCNFTSVNLNTFKIHLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSH 138 + C +C + HL KH ++PF CK C GF S H L RH +H Sbjct: 13 YICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCK-----EEGCEKGFTSLHHLTRHSLTH 67 Query: 139 DEDKKCYPCDQKNCNKRFTTLSNLKMHMVR--HGKPLTLCCEELGCGRKFQTMKQYSTHL 196 +K + CD C+ RFTT +N+K H R + K C CG+ F+ Q H Sbjct: 68 TGEKN-FTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKKHNQLKVHQ 126 Query: 197 KEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNP--EDLVCKGCGKQFKV 248 H+ PY C ++GC K F L + LK H++VH P +D C GK + + Sbjct: 127 FSHTQ-QLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTL 179
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-21
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-17
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-11
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-05
2ddh_A661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 9e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-04
1w07_A659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-04
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
 Score = 94.6 bits (236), Expect = 2e-23
 Identities = 58/202 (28%), Positives = 85/202 (42%), Gaps = 25/202 (12%)

Query: 99  HLLKHFDKRPFKCKLTTANNTPCMWGFFSKHKLLRHMTSHDEDKKCYPCDQKNCNKRFTT 158
                   + + C     +   C   +    KL  H+  H  +K  +PC ++ C K FT+
Sbjct: 3   EKALPVVYKRYIC-----SFADCGAAYNKNWKLQAHLCKHTGEKP-FPCKEEGCEKGFTS 56

Query: 159 LSNLKMHMVRH-G-KPLTLCCEELGCGRKFQTMKQYSTHLKEHSNV-----SAPYMCDYK 211
           L +L  H + H G K  T  C+  GC  +F T      ++K+H N         Y+C ++
Sbjct: 57  LHHLTRHSLTHTGEKNFT--CDSDGCDLRFTT----KANMKKHFNRFHNIKICVYVCHFE 110

Query: 212 GCGKSFYLMASLKSHQRVHVTNPEDLVCK--GCGKQFKVPCRLREHYKAVHESTKNFKCT 269
            CGK+F     LK HQ  H T      C   GC K+F +P RL+ H K VH      K  
Sbjct: 111 NCGKAFKKHNQLKVHQFSH-TQQLPYECPHEGCDKRFSLPSRLKRHEK-VHAGYPCKKD- 167

Query: 270 YDGCKLLFSTKSALKRHNKSKH 291
            D C  +  T +   +H    H
Sbjct: 168 -DSCSFVGKTWTLYLKHVAECH 188


>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.75
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.66
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.66
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.56
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.55
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.52
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.52
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.51
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.49
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.49
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.49
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.49
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.47
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.46
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.46
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.43
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.42
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.41
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.4
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.37
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.3
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.27
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.27
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.27
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.26
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.25
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.18
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.05
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.03
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.02
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.02
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.02
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.02
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.0
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.0
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.99
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.99
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.98
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.97
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.94
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.93
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.92
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.91
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.89
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.89
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.88
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.87
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.86
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.81
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.81
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.79
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.74
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.73
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.71
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.7
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.7
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.68
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.66
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.66
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.63
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.61
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.6
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.59
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.56
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.56
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.53
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.52
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.43
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.42
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.4
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.38
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.36
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.35
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.35
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.32
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.31
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.3
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.29
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.28
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.28
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.25
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.23
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.22
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.2
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.2
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.17
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.15
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.14
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.14
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.13
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.12
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.11
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.11
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.36
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.08
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.32
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.02
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.01
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.0
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.0
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.97
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.96
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.96
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.95
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.95
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.95
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.94
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.94
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.93
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.15
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.88
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.86
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.85
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.02
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.0
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.81
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.6
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.54
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.34
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.14
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.64
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.47
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.39
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.33
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.65
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.66
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.48
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 84.91
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 81.73
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 80.22
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.9e-37  Score=252.08  Aligned_cols=183  Identities=31%  Similarity=0.629  Sum_probs=139.9

Q ss_pred             HHHHHHHHHHhCCCCccccccccchhhcCChHHHHHHHHHcCCCCCCccccCCCCCccccChHHHHHHhhhhcCCCCccc
Q psy1773         159 LSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGCGKSFYLMASLKSHQRVHVTNPEDLV  238 (359)
Q Consensus       159 ~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~  238 (359)
                      ...|..|+..+.++++|.|..  |++.|.+...|..|++.|.+ +++|.|+.  |++.|.+...|..|+++|+ ++++|.
T Consensus         6 ~~~l~~h~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~-~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~~~~~~   79 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYACPE--CGKSFSRSDHLAEHQRTHTG-EKPYKCPE--CGKSFSDKKDLTRHQRTHT-GEKPYK   79 (190)
T ss_dssp             ---------------------------CCSSHHHHHGGGCC----CCEECTT--TCCEESSHHHHHHHHHHHH-CCCCEE
T ss_pred             hccchhhhhhcCCCCCCcCCC--CccccCCHHHHHHHHHHcCC-CCCccCCC--cCchhCCHHHHHHHHHhcC-CCCCcc
Confidence            456788888899999999999  99999999999999999886 78999987  9999999999999999984 558899


Q ss_pred             cCCcCccCCChHHHHHHHHHHccCCCccccccCCcCccccChHhhhccccccccCCcccCCCCCCcCcccCChHHHHHHH
Q psy1773         239 CKGCGKQFKVPCRLREHYKAVHESTKNFKCTYDGCKLLFSTKSALKRHNKSKHLNMRMFPCPLVTCGKSFLRSEHLQEHM  318 (359)
Q Consensus       239 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~~~C~~~f~~~~~l~~H~  318 (359)
                      |+.|++.|.+...|..|++ .|.++++|.|++  |++.|.+...|..|++ .|.++++|.|+.  |++.|.+...|..|+
T Consensus        80 C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~--C~~~f~~~~~l~~H~~-~h~~~~~~~C~~--C~~~f~~~~~L~~H~  153 (190)
T 2i13_A           80 CPECGKSFSQRANLRAHQR-THTGEKPYACPE--CGKSFSQLAHLRAHQR-THTGEKPYKCPE--CGKSFSREDNLHTHQ  153 (190)
T ss_dssp             CTTTCCEESCHHHHHHHHH-HHHTCCCEECTT--TCCEESSHHHHHHHHH-HHHCCCCEECTT--TCCEESCHHHHHHHH
T ss_pred             CcccCCccCCHHHHHHHHH-hcCCCCCCcCCC--CCCccCCHHHHHHHHH-HhCCCCCeECCC--CCcccCCHHHHHHHH
Confidence            9999999999999999988 888999999976  9999999999999998 689999999998  999999999999999


Q ss_pred             HhhcCCCCceeccCCCccccccchhhHHHHHhhhcCCC
Q psy1773         319 LQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTN  356 (359)
Q Consensus       319 ~~h~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~hh~~~  356 (359)
                      ++|++++ +|.|++  |++.|.++..|.+|++.|++++
T Consensus       154 ~~H~~~~-~~~C~~--C~~~f~~~~~L~~H~~~H~~~k  188 (190)
T 2i13_A          154 RTHTGEK-PYKCPE--CGKSFSRRDALNVHQRTHTGKK  188 (190)
T ss_dssp             HHHHCCC-CEECTT--TCCEESSHHHHHHHHTTC----
T ss_pred             HhcCCCC-CeECCC--CCCccCCHHHHHHHHHhcCCCC
Confidence            9999998 699999  9999999999999999998875



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.002
d2ddha2181 a.29.3.2 (A:475-655) Peroxisomal acyl-CoA oxidase- 3e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 8e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-04
d1w07a2198 a.29.3.2 (A:462-659) Acyl-coenzyme A oxidase 1, do 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcription factor sp1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.2 bits (92), Expect = 1e-05
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 205 PYMCDYKGCGKSFYLMASLKSHQRVH 230
           P+MC +  CGK F     L+ H+R H
Sbjct: 2   PFMCTWSYCGKRFTRSDELQRHKRTH 27


>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2ddha2 a.29.3.2 (A:475-655) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 181 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1w07a2 a.29.3.2 (A:462-659) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 198 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.51
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.24
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.21
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.17
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.12
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.09
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.07
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.06
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.04
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.04
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.02
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.01
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.0
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.99
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.95
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.89
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.89
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.89
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.86
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.85
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.83
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.83
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.76
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.75
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.71
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.6
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.51
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.41
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.39
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.13
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.06
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.98
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.94
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.85
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.78
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.75
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.75
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.68
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.64
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.62
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.6
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.56
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.55
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.54
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.52
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.49
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.49
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.47
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.45
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.34
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.34
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.33
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.32
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.28
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.25
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.15
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.11
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.04
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.03
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.99
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.93
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.74
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.65
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.64
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.6
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.38
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.37
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.3
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.27
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.11
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.04
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.89
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.84
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.8
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.41
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.2
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.18
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.17
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.14
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 94.95
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.7
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.7
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.66
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.64
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 94.43
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.24
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.16
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.14
d1y0jb136 U-shaped transcription factor, different fingers { 92.65
d1y0jb136 U-shaped transcription factor, different fingers { 92.33
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.04
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 91.4
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.4
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.07
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.73
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.52
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 86.96
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.28
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.06
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 85.12
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 84.08
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 83.08
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 80.11
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=2.8e-16  Score=96.39  Aligned_cols=53  Identities=30%  Similarity=0.625  Sum_probs=47.6

Q ss_pred             CcccCCCCCCcCcccCChHHHHHHHHhhcCCCCceeccCCCccccccchhhHHHHHhhh
Q psy1773         294 MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHV  352 (359)
Q Consensus       294 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h  352 (359)
                      ++||+| .  ||++|.....|..|+++|++++ ||.|++  ||++|.+.+.|.+|+++|
T Consensus         1 EK~y~C-~--Cgk~F~~~~~l~~H~~~Ht~ek-py~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-Q--CGKSFTHKSQRDRHMSMHLGLR-PYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-T--TSCEESSHHHHHHHHHHHSCCC-SEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-C--CCCeECCHHHhHHHhhcccccc-CCcCCC--cCCEecCHHHHHHHHhcC
Confidence            578999 5  9999999999999999999998 699988  999999999999998876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure